
All phycobilin lyases and related proteins


This list allows users to retrieve any sequence from any organism included in the database by its locus tag/orf id or Genbank number when available.

Gene Locus tag Genbank Species Strain PBP in rods Pigment type Remark Length Last change
CpcE/RpcE family WH7805_06756 ZP_01123351.1 Synechococcus sp. WH7805 PC+PEI 2 The R-PC-III present in this strain has a PCB:PEB ratio of 2:1 (Sidler, 1994). It is unclear whether WH7805 has CpcE/F or RpcE/F but the presence of CpcT (and not RpcT) however argues for the following pigmentation: alpha-84=PEB; beta-84=PCB; beta-155=PCB. 265 09-19-2012
CpcE/RpcE family SynRCC307_2066 YP_001228322.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA Unclear whether this strain has CpcE/F or RpcE/F 274 12-06-2011
CpcE/RpcE family S7335_2363 ZP_05035931.1 Synechococcus sp. PCC7335 PC+PEI CA3 CpcEII or RpcE 274 12-06-2011
CpcE-I subfamily SYNPCC7002_A2213 YP_001735449.1 Synechococcus sp. PCC7002 PC 1 268 09-26-2011
CpcE-I subfamily slr1878 NP_441003.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 272 09-26-2011
CpcE-I subfamily AM1_C0118 YP_001521564.1 Acaryochloris marina MBIC11017 (AM1) PC 1 on preb3 plasmid 274 09-26-2011
CpcE-I subfamily alr0532 NP_484576.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 276 12-06-2011
CpcE-I subfamily Ava_2934 YP_323440.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 276 12-06-2011
CpcE-I subfamily Aazo_3485 YP_003722225.1 Anabaena (Nostoc) azollae 0708 PC+PEC 276 12-06-2011
CpcE-I subfamily AmaxDRAFT_0381 ZP_03271564.1 Arthrospira (Spirulina) maxima CS-328 PC 1 291 09-26-2011
CpcE-I subfamily CwatDRAFT_3431 ZP_00516610.1 Crocosphaera watsonii WH8501 PC+PEI Not clustered with cpcF-I. This strain also possesses an RpcG-like sequence which should act on the same alpha-PC binding site as CpcE/F. 284 10-30-2012
CpcE-I subfamily cce_2656 YP_001804070.1 Cyanothece sp. ATCC51142 PC 1 285 09-26-2011
CpcE-I subfamily PCC7424_0156 YP_002375494.1 Cyanothece sp. PCC7424 PC+PEI 2 284 12-06-2011
CpcE-I subfamily Cyan7425_1692 YP_002482422.1 Cyanothece sp. PCC7425 PC 1 276 09-26-2011
CpcE-I subfamily PCC8801_3079 YP_002373216.1 Cyanothece sp. PCC8801 PC+PEI 2 284 12-06-2011
CpcE-I subfamily Cyan8802_3041 YP_003138722.1 Cyanothece sp. PCC8802 PC 1 284 09-26-2011
CpcE-I subfamily Cyan7822_1647 YP_003886912.1 Cyanothece sp. PCC7822 PC+PEI 2 285 12-06-2011
CpcE-I subfamily gi|111610620|gb|ABH11707.1| ABH11707.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 294 12-06-2011
CpcE-I subfamily gi|581258|emb|CAA30066.1| CAA30066.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 275 12-06-2011
CpcE-I subfamily FJSC11DRAFT_0792 ZP_08984586.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 276 12-06-2011
CpcE-I subfamily gvip185 NP_924214.1 Gloeobacter violaceus PCC7421 PC+PEI 2 247 12-06-2011
CpcE-I subfamily GL6909_6154 Gloeothece sp. PCC6909/1 PC+PEI 2 284 12-06-2011
CpcE-I subfamily L8106_02267 ZP_01619122.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 275 09-26-2011
CpcE-I subfamily MC7420_3712 ZP_05028456.1 Microcoleus chthonoplastes PCC7420 PC+PEC 275 12-06-2011
CpcE-I subfamily MAE_27970 YP_001657811.1 Microcystis aeruginosa NIES-843 PC 1 270 09-26-2011
CpcE-I subfamily N9414_13270 ZP_01632751.1 Nodularia spumigena CCY9414 PC 1 Sequence incomplete: lacks C-term (end of contig) 158 01-10-2012
CpcE-I subfamily Npun_F5294 YP_001868558.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 280 12-06-2011
CpcE-I subfamily Synpcc7942_1054 YP_400071.1 Synechococcus elongatus PCC7942 PC 1 273 09-26-2011
CpcE-I subfamily syc0494_c YP_171204.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 273 09-26-2011
CpcE-I subfamily CYB_2736 YP_478924.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 This is a second copy of cpcE (cpcE-2) NOT associated with a cpcF 276 12-06-2011
CpcE-I subfamily CYB_0942 YP_477184.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 250 09-26-2011
CpcE-I subfamily CYA_2040 YP_475443.1 Synechococcus sp. JA-3-3Ab PC 1 This is a second copy of cpcE (cpcE-2) NOT associated with a cpcF 275 12-06-2011
CpcE-I subfamily CYA_0217 YP_473704.1 Synechococcus sp. JA-3-3Ab PC 1 250 09-26-2011
CpcE-I subfamily tlr1961 NP_682751.1 Thermosynechococcus elongatus BP-1 PC 1 276 09-26-2011
CpcE-I subfamily Tery_5047 YP_724428.1 Trichodesmium erythraeum IMS101 PC+PEI We thought it was RpcE: why? 289 12-06-2011
CpcE-I subfamily CMJ043C Cyanidioschyzon merolae 10D PC 1 Distantly related to cyanobacterial CpcE : many insertions in matching sequences and much longer N-term, found by tblastn 516 02-21-2012
CpcE-I subfamily IPF_4760 CAO90470.1 Microcystis aeruginosa PCC7806 PC 1 270 10-20-2011
CpcE-I subfamily NIES39_D02010 BAI89621.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 291 10-20-2011
CpcE-I subfamily ZP_08490943.1 ZP_08490943.1 Microcoleus vaginatus FGP-2 PC 1 279 10-20-2011
CpcE-I subfamily LYNGBM3L_16670 ZP_08428232.1 Lyngbya majuscula 3L PC+PEI 2 278 10-19-2011
CpcE-I subfamily OSCI_2780025 ZP_07110957.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 276 10-19-2011
CpcE-I subfamily CRC_01962 ZP_06308542.1 Cylindrospermopsis raciborskii CS-505 PC 1 274 10-19-2011
CpcE-I subfamily CRD_01230 ZP_06304367.1 Raphidiopsis brookii D9 PC 1 274 12-06-2011
CpcE-I subfamily PCC_0625 YP_002049261.1 Paulinella chromatophora M0880 PC 1 286 12-05-2011
CpcE-I subfamily Cy51472DRAFT_1653 ZP_08972857.1 Cyanothece sp. ATCC51472 PC 1 285 01-10-2012
CpcE-I subfamily AplaP_010100003287 ZP_06380690.1 Arthrospira (Spirulina) platensis Paraca PC 1 291 01-24-2012
CpcE-I subfamily CWATWH0003_3128t1 EHJ12159.1 Crocosphaera watsonii WH0003 PC+PEI Incomplete (end of contig) 212 02-22-2012
CpcE-I subfamily MICAK_2510017 CCI36535.1 Microcystis aeruginosa PCC9701 PC 1 270 08-23-2012
CpcE-I subfamily MICAG_2690003 CCI25064.1 Microcystis aeruginosa PCC9808 PC 1 270 08-22-2012
CpcE-I subfamily MICAD_1130002 CCI05527.1 Microcystis aeruginosa PCC7941 PC 1 270 08-23-2012
CpcE-I subfamily MICAC_4030008 CCI03035.1 Microcystis aeruginosa PCC9443 PC 1 270 08-23-2012
CpcE-I subfamily MICAB_5440004 CCH98842.1 Microcystis aeruginosa PCC9717 PC 1 270 08-23-2012
CpcE-I subfamily MICCA_2170004 ZP_18816838.1 Microcystis aeruginosa PCC9432 PC 1 270 04-22-2013
CpcE-I subfamily MICAI_2630007 ZP_10228400.1 Microcystis sp. T1-4 PC+PEI 2 270 08-22-2012
CpcE-I subfamily Osc7112_2004 YP_007114894.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 279 04-23-2013
CpcE-I subfamily Scytonema_PCC7110_joined_1634 Scytonema hofmanni PCC7110 PC+PEC 276 06-12-2013
CpcE-I subfamily FisPCC73103_3439 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 276 06-12-2013
CpcE-I subfamily FisPCC7414_3831 Fischerella muscicola PCC7414 PC+PEC 276 06-12-2013
CpcE-I subfamily Fischerella_sp._PCC7521_721 Fischerella thermalis PCC7521 PC+PEC 276 06-12-2013
CpcE-I subfamily Chloroglopsis_PCC9212_joined_2970 Chlorogloeopsis sp. PCC9212 PC+PEC 276 06-12-2013
CpcE-I subfamily UYC_06435 Chlorogloeopsis fritschii PCC6912 PC+PEC 276 06-12-2013
CpcE-I subfamily Cal6303_3401 YP_007138308.1 Calothrix sp. PCC6303 PC+PEI 2 N-term shortened (34 aa) 274 07-02-2013
CpcE-I subfamily Cal7507_3703 YP_007066928.1 Calothrix sp. PCC7507 PC+PEC 276 04-29-2013
CpcE-I subfamily Osc10802DRAFT_3759 Oscillatoria sp. PCC10802 PC+PEI 276 06-12-2013
CpcE-I subfamily Oscil6304_1239 YP_007084874.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 281 04-29-2013
CpcE-I subfamily FIS9605DRAFT_06542 Fischerella sp. PCC9605 PC+PEC 276 06-12-2013
CpcE-I subfamily Fis9431DRAFT_3458 Fischerella sp. PCC9431 PC+PEC 276 06-12-2013
CpcE-I subfamily PCC9339DRAFT_01808 Fischerella sp. PCC9339 PC+PEC 276 06-12-2013
CpcE-I subfamily Nos7524_4177 YP_007077540.1 Nostoc sp. PCC7524 PC+PEC 276 04-23-2013
CpcE-I subfamily Nos7107_3141 YP_007050881.1 Nostoc sp. PCC7107 PC+PEC 284 04-29-2013
CpcE-I subfamily Cylst_0755 YP_007145762.1 Cylindrospermum stagnale PCC7417 PC+PEC 284 04-23-2013
CpcE-I subfamily Anacy_1900 YP_007156298.1 Anabaena cylindrica PCC7122 PC+PEC 276 04-23-2013
CpcE-I subfamily Ana7108_1540 Anabaena sp. PCC7108 PC+PEC 276 06-12-2013
CpcE-I subfamily Riv7116_3561 YP_007056560.1 Rivularia sp. PCC7116 PC+PEC 275 04-23-2013
CpcE-I subfamily Syn7509DRAFT_00024770 ZP_21041085.1 Synechocystis sp. PCC7509 PC 266 06-20-2013
CpcE-I subfamily Glo7428_4602 YP_007130198.1 Gloeocapsa sp. PCC7428 PC 273 04-23-2013
CpcE-I subfamily Chro_3411 YP_007092739.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 272 04-23-2013
CpcE-I subfamily Dacsa_0532 YP_007170672.1 Dactylococcopsis salina PCC8305 262 04-23-2013
CpcE-I subfamily PCC7418_2470 YP_007168831.1 Halothece sp. PCC7418 PC 263 04-23-2013
CpcE-I subfamily Ple7327_2230 YP_007081103.1 Pleurocapsa sp. PCC7327 PC+PEI 293 04-23-2013
CpcE-I subfamily GLO73106DRAFT_00012720 ZP_21051608.1 Gloeocapsa sp. PCC73106 PC+PEI 275 04-23-2013
CpcE-I subfamily Lepto7376_2325 YP_007071446.1 Leptolyngbya sp. PCC7376 PC+PEI 270 04-23-2013
CpcE-I subfamily Cyast_0723 YP_007164345.1 Cyanobacterium stanieri PCC7202 PC 275 04-23-2013
CpcE-I subfamily Cyan10605_1973 YP_007162112.1 Cyanobacterium aponimum PCC10605 274 06-12-2013
CpcE-I subfamily Sta7437_0254 YP_007130837.1 Stanieria cyanosphaera PCC7437 PC+PEI 278 04-29-2013
CpcE-I subfamily Xen7305DRAFT_00020280 ZP_21056138.1 Xenococcus sp. PCC7305 PC+PEI 271 04-23-2013
CpcE-I subfamily Mic7113_2593 YP_007121792.1 Microcoleus sp. PCC7113 PC+PEI 2 284 04-23-2013
CpcE-I subfamily Cri9333_1814 YP_007142209.1 Crinalium epipsammum PCC9333 PC 283 06-20-2013
CpcE-I subfamily Cha6605_1301 YP_007096023.1 Chamaesiphon minutus PCC6605 PC+PEI 271 06-20-2013
CpcE-I subfamily Lep6406DRAFT_00020730 ZP_21046666.1 Leptolyngbya sp. PCC6406 PC+PEC 267 04-29-2013
CpcE-I subfamily ZP_18907676 ZP_18907676.1 Leptolyngbya sp. PCC7375 PC+PEI 2 Low protomatch score 279 06-20-2013
CpcE-I subfamily GEI7407_3506 YP_007111025.1 Geitlerinema sp. PCC7407 PC 279 06-20-2013
CpcE-I subfamily LepboDRAFT_3198 Leptolyngbya boryana PCC6306 PC 278 06-11-2013
CpcE-I subfamily Syn6312_2505 YP_007062148.1 Synechococcus sp. PCC6312 PC 292 06-12-2013
CpcE-I subfamily Syn7502_03299 YP_007107300.1 Synechococcus sp. PCC7502 PC 270 06-20-2013
CpcE-I subfamily Pse7429DRAFT_3557 ZP_21066937.1 Pseudanabaena sp. (biceps) PCC7429 PC 271 04-23-2013
CpcE-I subfamily Pse7367_3924 YP_007083576.1 Pseudanabaena sp. PCC7367 PC+PEI 2 copies? 303 06-20-2013
CpcE-I subfamily Pse7367_2387 YP_007103076.1 Pseudanabaena sp. PCC7367 PC+PEI 2 copies? 273 06-20-2013
CpcE-I subfamily ZP_20932178 ZP_20932178.1 Microcystis aeruginosa TAIHU98 PC 1 270 04-23-2013
CpcE-II subfamily RS9917_02908 ZP_01080764.1 Synechococcus sp. RS9917 PC 1 285 12-06-2011
CpcE-II subfamily WH5701_05890 ZP_01083798.1 Synechococcus sp. WH5701 PC 1 282 12-06-2011
CpcE-II subfamily SCB01_010100012952 ZP_07974572.1 Synechococcus sp. CB0101 PC 1 MGPAAMAASPSPSFWA removed at the beginning 290 12-06-2011
CpcE-II subfamily SCB02_010100004415 ZP_07970152.1 Synechococcus sp. CB0205 PC+PEI 2 275 12-06-2011
CpcE-II subfamily CPCC7001_1137 ZP_05044949.1 Cyanobium sp. PCC7001 PC 1 274 12-06-2011
CpcE-II subfamily Cyagr_1640 YP_007046132.1 Cyanobium gracile PCC6307 PC 273 04-29-2013
RpcE subfamily sync_0486 YP_729713.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A N-term extended 265 09-28-2012
RpcE subfamily SH8109_0092 ZP_05789298.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB Sequence was incomplete (updated by FP) 257 12-05-2011
RpcE subfamily Syncc9902_1911 YP_377912.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 256 09-26-2011
RpcE subfamily SynWH7803_0477 YP_001224200.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 256 09-26-2011
RpcE subfamily Syn8016DRAFT_2740 ZP_08957393.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 269 11-04-2011
RpcE subfamily SynWH8020_rpcE AAA27348.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A 265 08-26-2012
CpcF/RpcF family WH7805_06761 ZP_01123352.1 Synechococcus sp. WH7805 PC+PEI 2 Unclear whether this strain has CpcE/F or RpcE/F. Two possibilities:
a-84 and b-84 = PCB; b-155 = PEB
a-84 = PEB,b-84 and b-155 = PCB
212 12-06-2011
CpcF/RpcF family SynRCC307_2067 YP_001228323.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA Unclear whether this strain has CpcE/F or RpcE/F 218 12-06-2011
CpcF/RpcF family S7335_4405 ZP_05037964.1 Synechococcus sp. PCC7335 PC+PEI CA3 CpcFII or RpcF 225 12-06-2011
CpcF-I subfamily SYNPCC7002_A2214 YP_001735450.1 Synechococcus sp. PCC7002 PC 1 213 09-26-2011
CpcF-I subfamily sll1051 NP_439974.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 214 09-26-2011
CpcF-I subfamily AM1_C0272 YP_001521703.1 Acaryochloris marina MBIC11017 (AM1) PC 1 on preb3 plasmid 217 09-26-2011
CpcF-I subfamily alr0533 NP_484577.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 200 12-06-2011
CpcF-I subfamily Ava_2935 YP_323441.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 200 12-06-2011
CpcF-I subfamily Aazo_3484 YP_003722224.1 Anabaena (Nostoc) azollae 0708 PC+PEC 203 12-06-2011
CpcF-I subfamily AmaxDRAFT_0380 ZP_03271563.1 Arthrospira (Spirulina) maxima CS-328 PC 1 210 09-26-2011
CpcF-I subfamily CwatDRAFT_6054 ZP_00513615.1 Crocosphaera watsonii WH8501 PC+PEI Not clustered with cpcE-I. This strain also possesses an RpcG-like sequence which should act on the same alpha-PC binding site as CpcE/F. 194 10-30-2012
CpcF-I subfamily cce_2308 YP_001803724.1 Cyanothece sp. ATCC51142 PC 1 215 09-26-2011
CpcF-I subfamily PCC7424_0661 YP_002375988.1 Cyanothece sp. PCC7424 PC+PEI 2 215 12-06-2011
CpcF-I subfamily Cyan7425_1691 YP_002482421.1 Cyanothece sp. PCC7425 PC 1 209 09-26-2011
CpcF-I subfamily PCC8801_3073 YP_002373210.1 Cyanothece sp. PCC8801 PC+PEI 2 215 12-06-2011
CpcF-I subfamily Cyan8802_3047 YP_003138728.1 Cyanothece sp. PCC8802 PC 1 215 09-26-2011
CpcF-I subfamily CY0110_25371 ZP_01730772.1 Cyanothece sp. CCY0110 PC 1 220 09-26-2011
CpcF-I subfamily Cyan7822_2446 YP_003887696.1 Cyanothece sp. PCC7822 PC+PEI 2 226 12-06-2011
CpcF-I subfamily gi|111610621|gb|ABH11708.1| ABH11708.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 273 12-06-2011
CpcF-I subfamily FJSC11DRAFT_0791 ZP_08984585.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 205 12-06-2011
CpcF-I subfamily gvip186 NP_924215.1 Gloeobacter violaceus PCC7421 PC+PEI 2 193 12-06-2011
CpcF-I subfamily GL6909_0679 Gloeothece sp. PCC6909/1 PC+PEI 2 220 12-06-2011
CpcF-I subfamily L8106_02272 ZP_01619123.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 211 09-26-2011
CpcF-I subfamily MC7420_3666 ZP_05028410.1 Microcoleus chthonoplastes PCC7420 PC+PEC 216 12-06-2011
CpcF-I subfamily MAE_27950 YP_001657809.1 Microcystis aeruginosa NIES-843 PC 1 207 09-26-2011
CpcF-I subfamily N9414_13265 ZP_01631845.1 Nodularia spumigena CCY9414 PC 1 198 09-26-2011
CpcF-I subfamily Npun_F5295 YP_001868559.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 241 12-06-2011
CpcF-I subfamily Synpcc7942_1055 YP_400072.1 Synechococcus elongatus PCC7942 PC 1 207 09-26-2011
CpcF-I subfamily syc0493_c YP_171203.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 207 09-26-2011
CpcF-I subfamily CYB_0943 YP_477185.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 N-term shortened: 16 aa removed by FP (MPLISGFKCTFDYSLP) 213 09-26-2011
CpcF-I subfamily CYA_0216 YP_473703.1 Synechococcus sp. JA-3-3Ab PC 1 N-term shortened: 25 aa removed by FP (MGLSPPIGSLGCFVSFLLTLASGLS) 213 09-26-2011
CpcF-I subfamily tlr1962 NP_682752.1 Thermosynechococcus elongatus BP-1 PC 1 213 09-26-2011
CpcF-I subfamily Tery_5046 YP_724427.1 Trichodesmium erythraeum IMS101 PC+PEI We thought it was RpcF, why? 214 12-06-2011
CpcF-I subfamily CMJ044C Cyanidioschyzon merolae 10D PC 1 found by tblastn 312 02-21-2012
CpcF-I subfamily IPF_4758 CAO90472.1 Microcystis aeruginosa PCC7806 PC 1 207 10-20-2011
CpcF-I subfamily NIES39_D02000 BAI89620.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 210 10-20-2011
CpcF-I subfamily ZP_08490942.1 ZP_08490942.1 Microcoleus vaginatus FGP-2 PC 1 208 10-20-2011
CpcF-I subfamily LYNGBM3L_16650 ZP_08428231.1 Lyngbya majuscula 3L PC+PEI 2 212 10-19-2011
CpcF-I subfamily OSCI_2780026 ZP_07110958.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 209 10-19-2011
CpcF-I subfamily CRC_01963 ZP_06308543.1 Cylindrospermopsis raciborskii CS-505 PC 1 216 10-19-2011
CpcF-I subfamily CRD_01231 ZP_06304368.1 Raphidiopsis brookii D9 PC 1 216 12-06-2011
CpcF-I subfamily PCC_0624 YP_002049260.1 Paulinella chromatophora M0880 PC 1 224 12-05-2011
CpcF-I subfamily Cy51472DRAFT_1994 ZP_08973198.1 Cyanothece sp. ATCC51472 PC 1 215 01-10-2012
CpcF-I subfamily AplaP_010100003292 ZP_06380691.1 Arthrospira (Spirulina) platensis Paraca PC 1 210 01-24-2012
CpcF-I subfamily CWATWH0003_3385 EHJ11901.1 Crocosphaera watsonii WH0003 PC+PEI 212 02-22-2012
CpcF-I subfamily MICAK_2510015 CCI36533.1 Microcystis aeruginosa PCC9701 PC 1 207 08-23-2012
CpcF-I subfamily MICAG_2680028 CCI25051.1 Microcystis aeruginosa PCC9808 PC 1 207 08-22-2012
CpcF-I subfamily MICAD_1110027 CCI05522.1 Microcystis aeruginosa PCC7941 PC 1 207 08-23-2012
CpcF-I subfamily MICAC_4070001 CCI03038.1 Microcystis aeruginosa PCC9443 PC 1 207 08-23-2012
CpcF-I subfamily MICAB_5440002 CCH98840.1 Microcystis aeruginosa PCC9717 PC 1 207 08-23-2012
CpcF-I subfamily MICCA_2150045 ZP_18816833.1 Microcystis aeruginosa PCC9432 PC 1 207 04-22-2013
CpcF-I subfamily MICAI_2630009 ZP_10228402.1 Microcystis sp. T1-4 PC+PEI 2 207 08-22-2012
CpcF-I subfamily Osc7112_2003 YP_007114893.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 208 04-23-2013
CpcF-I subfamily Scytonema_PCC7110_joined_1635 Scytonema hofmanni PCC7110 PC+PEC 206 06-12-2013
CpcF-I subfamily FisPCC73103_3438 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 212 06-12-2013
CpcF-I subfamily FisPCC7414_3830 Fischerella muscicola PCC7414 PC+PEC 207 06-12-2013
CpcF-I subfamily Fischerella_sp._PCC7521_722 Fischerella thermalis PCC7521 PC+PEC 205 06-12-2013
CpcF-I subfamily Chloroglopsis_PCC9212_joined_2969 Chlorogloeopsis sp. PCC9212 PC+PEC 201 06-12-2013
CpcF-I subfamily UYC_06434 Chlorogloeopsis fritschii PCC6912 PC+PEC 201 06-12-2013
CpcF-I subfamily Cal6303_3400 YP_007138307.1 Calothrix sp. PCC6303 PC+PEI 2 241 04-29-2013
CpcF-I subfamily Cal7507_3704 YP_007066929.1 Calothrix sp. PCC7507 PC+PEC 200 04-29-2013
CpcF-I subfamily Osc10802DRAFT_3758 Oscillatoria sp. PCC10802 PC+PEI N-term shortened (17 aa) 218 07-02-2013
CpcF-I subfamily Oscil6304_1240 YP_007084875.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 217 04-29-2013
CpcF-I subfamily FIS9605DRAFT_06543 Fischerella sp. PCC9605 PC+PEC 207 06-12-2013
CpcF-I subfamily Fis9431DRAFT_3457 Fischerella sp. PCC9431 PC+PEC 212 06-12-2013
CpcF-I subfamily PCC9339DRAFT_01807 Fischerella sp. PCC9339 PC+PEC 212 06-12-2013
CpcF-I subfamily Nos7524_4178 YP_007077541.1 Nostoc sp. PCC7524 PC+PEC 200 04-23-2013
CpcF-I subfamily Nos7107_3140 YP_007050880.1 Nostoc sp. PCC7107 PC+PEC 199 04-29-2013
CpcF-I subfamily Cylst_0756 YP_007145763.1 Cylindrospermum stagnale PCC7417 PC+PEC 200 04-23-2013
CpcF-I subfamily Anacy_1901 YP_007156299.1 Anabaena cylindrica PCC7122 PC+PEC 200 04-23-2013
CpcF-I subfamily Ana7108_1539 Anabaena sp. PCC7108 PC+PEC 198 06-12-2013
CpcF-I subfamily Riv7116_3560 YP_007056559.1 Rivularia sp. PCC7116 PC+PEC 206 04-23-2013
CpcF-I subfamily Syn7509DRAFT_00024760 ZP_21041084.1 Synechocystis sp. PCC7509 PC 206 06-20-2013
CpcF-I subfamily Glo7428_4601 YP_007130197.1 Gloeocapsa sp. PCC7428 PC 208 04-23-2013
CpcF-I subfamily Chro_3412 YP_007092740.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 212 04-23-2013
CpcF-I subfamily Dacsa_0415 YP_007170561.1 Dactylococcopsis salina PCC8305 206 06-20-2013
CpcF-I subfamily PCC7418_1993 YP_007168373.1 Halothece sp. PCC7418 PC 196 06-20-2013
CpcF-I subfamily Ple7327_3797 YP_007082522.1 Pleurocapsa sp. PCC7327 PC+PEI 240 04-23-2013
CpcF-I subfamily GLO73106DRAFT_00012730 ZP_21051609.1 Gloeocapsa sp. PCC73106 PC+PEI 219 04-23-2013
CpcF-I subfamily Lepto7376_2326 YP_007071447.1 Leptolyngbya sp. PCC7376 PC+PEI 221 04-23-2013
CpcF-I subfamily Cyast_1932 YP_007165534.1 Cyanobacterium stanieri PCC7202 PC 213 04-23-2013
CpcF-I subfamily Cyan10605_2164 YP_007162294.1 Cyanobacterium aponimum PCC10605 218 06-12-2013
CpcF-I subfamily Sta7437_0255 YP_007130838.1 Stanieria cyanosphaera PCC7437 PC+PEI 228 06-20-2013
CpcF-I subfamily Xen7305DRAFT_00020290 ZP_21056139.1 Xenococcus sp. PCC7305 PC+PEI 206 04-23-2013
CpcF-I subfamily Mic7113_2594 YP_007121793.1 Microcoleus sp. PCC7113 PC+PEI 2 213 04-23-2013
CpcF-I subfamily Dacsa_0415 YP_007142210.1 Crinalium epipsammum PCC9333 PC 206 06-20-2013
CpcF-I subfamily Cha6605_3627 YP_007098137.1 Chamaesiphon minutus PCC6605 PC+PEI 269 04-29-2013
CpcF-I subfamily Lep6406DRAFT_00020740 ZP_21046667.1 Leptolyngbya sp. PCC6406 PC+PEC 237 04-29-2013
CpcF-I subfamily ZP_18907677 ZP_18907677.1 Leptolyngbya sp. PCC7375 PC+PEI 2 213 04-23-2013
CpcF-I subfamily GEI7407_3505 YP_007111024.1 Geitlerinema sp. PCC7407 PC 229 06-20-2013
CpcF-I subfamily LepboDRAFT_3197 Leptolyngbya boryana PCC6306 PC 271 06-11-2013
CpcF-I subfamily Syn6312_2504 YP_007062147.1 Synechococcus sp. PCC6312 PC 225 06-12-2013
CpcF-I subfamily Syn7502_03300 YP_007107301.1 Synechococcus sp. PCC7502 PC 210 06-20-2013
CpcF-I subfamily Pse7429DRAFT_3558 ZP_21066938.1 Pseudanabaena sp. (biceps) PCC7429 PC 282 04-23-2013
CpcF-I subfamily Pse7367_3925 YP_007083577.1 Pseudanabaena sp. PCC7367 PC+PEI 256 06-20-2013
CpcF-I subfamily ZP_20932486 ZP_20932486.1 Microcystis aeruginosa TAIHU98 PC 1 207 04-23-2013
CpcF-II subfamily RS9917_02913 ZP_01080765.1 Synechococcus sp. RS9917 PC 1 219 12-06-2011
CpcF-II subfamily WH5701_05885 ZP_01083797.1 Synechococcus sp. WH5701 PC 1 222 12-06-2011
CpcF-II subfamily SCB01_010100012947 ZP_07974571.1 Synechococcus sp. CB0101 PC 1 220 12-06-2011
CpcF-II subfamily SCB02_010100004420 ZP_07970153.1 Synechococcus sp. CB0205 PC+PEI 2 N-term possibly 5aa too long 228 12-06-2011
CpcF-II subfamily CPCC7001_1598 ZP_05045410.1 Cyanobium sp. PCC7001 PC 1 223 12-06-2011
CpcF-II subfamily Cyagr_1641 YP_007046133.1 Cyanobium gracile PCC6307 PC 220 04-29-2013
RpcF subfamily sync_0485 YP_729712.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 209 09-26-2011
RpcF subfamily SH8109_0093 ZP_05790743.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB Sequence was incomplete (updated by FP) 210 12-05-2011
RpcF subfamily Syncc9902_1912 YP_377913.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 210 09-26-2011
RpcF subfamily SynWH7803_0476 YP_001224199.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 210 09-26-2011
RpcF subfamily Syn8016DRAFT_2739 ZP_08957392.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 211 11-04-2011
RpcF subfamily SynWH8020_rpcF AAA27349.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A 209 08-26-2012
CpeY family sync_0499 YP_729726.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 442 09-26-2011
CpeY family Syncc9605_0429 YP_380760.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 441 09-26-2011
CpeY family SH8109_0080 ZP_05789451.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 441 09-26-2011
CpeY family SYNW2013 NP_898104.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 441 09-26-2011
CpeY family Syncc9902_1898 YP_377899.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 441 09-26-2011
CpeY family BL107_08931 ZP_01469889.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 444 09-26-2011
CpeY family SynWH7803_0491 YP_001224214.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 430 09-26-2011
CpeY family WH7805_06686 ZP_01123337.1 Synechococcus sp. WH7805 PC+PEI 2 427 09-26-2011
CpeY family RS9916_40211 ZP_01473085.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 440 09-26-2011
CpeY family SynRCC307_2053 YP_001228309.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 441 09-26-2011
CpeY family SCB02_010100004298 ZP_07970129.1 Synechococcus sp. CB0205 PC+PEI 2 427 11-04-2011
CpeY family S7335_3216 ZP_05036780.1 Synechococcus sp. PCC7335 PC+PEI CA3 N-term shortened (11 aa removed by FP: MQAAFDRFLTA) 420 09-26-2011
CpeY family Syn8016DRAFT_2753 ZP_08957406.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 438 11-04-2011
CpeY family NATL1_03891 YP_001014218.1 Prochlorococcus marinus NATL1A PEIII high b/a 434 09-26-2011
CpeY family PMN2A_1675 YP_292866.1 Prochlorococcus marinus NATL2A PEIII high b/a 434 09-26-2011
CpeY family Pro0341 NP_874735.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 439 09-26-2011
CpeY family P9211_03361 YP_001550221.1 Prochlorococcus marinus MIT9211 PEIII High b/a 441 09-26-2011
CpeY family P9303_22321 YP_001018232.1 Prochlorococcus sp. MIT9303 PEIII high b/a 449 09-26-2011
CpeY family PMT1679 NP_895506.1 Prochlorococcus sp. MIT9313 PEIII high b/a 449 09-26-2011
CpeY family CwatDRAFT_0665 ZP_00518425.1 Crocosphaera watsonii WH8501 PC+PEI There is another partial CpeY sequence in this genome almost 100% identical to this one (possibly an assembly error). 419 08-27-2012
CpeY family CwatDRAFT_5980 ZP_00514215.1 Crocosphaera watsonii WH8501 PC+PEI Sequence incomplete. N-term extended (35 aa added) but still incomplete. 282 08-27-2012
CpeY family PCC7424_5731 YP_002381026.1 Cyanothece sp. PCC7424 PC+PEI 2 431 09-26-2011
CpeY family PCC8801_4512 YP_002364790.1 Cyanothece sp. PCC8801 PC+PEI 2 425 09-26-2011
CpeY family Cyan7822_4045 YP_003889245.1 Cyanothece sp. PCC7822 PC+PEI 2 431 09-26-2011
CpeY family gi|47606672|gb|AAT36318.1| AAT36318.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 429 09-26-2011
CpeY family gvip158 NP_924134.1 Gloeobacter violaceus PCC7421 PC+PEI 2 428 11-24-2011
CpeY family GL6909_3532 Gloeothece sp. PCC6909/1 PC+PEI 2 431 06-06-2011
CpeY family Npun_R3801 YP_001867128.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 427 09-26-2011
CpeY family Tery_0990 YP_720843.1 Trichodesmium erythraeum IMS101 PC+PEI 425 09-26-2011
CpeY family LYNGBM3L_56120 ZP_08427724.1 Lyngbya majuscula 3L PC+PEI 2 427 10-19-2011
CpeY family CWATWH0003_0669 EHJ14661.1 Crocosphaera watsonii WH0003 PC+PEI 426 02-22-2012
CpeY family MICAI_2830023 ZP_10228735.1 Microcystis sp. T1-4 PC+PEI 2 420 08-22-2012
CpeY family SynWH8020_cpeY AAA27337.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A N-term extended (23 aa added) 442 08-27-2012
CpeY family Osc7112_1033 YP_007114007.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 429 04-23-2013
CpeY family Cal6303_1007 YP_007136044.1 Calothrix sp. PCC6303 PC+PEI 2 427 04-29-2013
CpeY family Cal6303_4892 YP_007139762.1 Calothrix sp. PCC6303 PC+PEI 2 421 04-29-2013
CpeY family Osc10802DRAFT_5372 Oscillatoria sp. PCC10802 PC+PEI 427 06-12-2013
CpeY family Ple7327_1467 YP_007080403.1 Pleurocapsa sp. PCC7327 PC+PEI N-terml shortened (16 aa) 427 07-02-2013
CpeY family GLO73106DRAFT_00012680 ZP_21051604.1 Gloeocapsa sp. PCC73106 PC+PEI 422 04-23-2013
CpeY family Lepto7376_4083 YP_007073046.1 Leptolyngbya sp. PCC7376 PC+PEI 422 04-23-2013
CpeY family Sta7437_4287 YP_007134724.1 Stanieria cyanosphaera PCC7437 PC+PEI 426 04-29-2013
CpeY family Xen7305DRAFT_00050160 ZP_21053197.1 Xenococcus sp. PCC7305 PC+PEI 422 04-23-2013
CpeY family Mic7113_4748 YP_007123827.1 Microcoleus sp. PCC7113 PC+PEI 2 426 04-23-2013
CpeY family Cha6605_4053 YP_007098536.1 Chamaesiphon minutus PCC6605 PC+PEI N-term shortened (25 aa) 430 07-02-2013
CpeY family ZP_18907655 ZP_18907655.1 Leptolyngbya sp. PCC7375 PC+PEI 2 427 06-20-2013
CpeY family Pse7367_3888 YP_007083545.1 Pseudanabaena sp. PCC7367 PC+PEI 442 04-23-2013
CpeZ family sync_0500 YP_729727.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A N-term shortened (15aa removed by FP: LLLSPAKIVKSSSCV) 208 09-26-2011
CpeZ family Syncc9605_0430 YP_380761.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 212 09-26-2011
CpeZ family SH8109_0079 ZP_05789880.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 212 09-26-2011
CpeZ family SYNW2012 NP_898103.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 206 09-26-2011
CpeZ family Syncc9902_1897 YP_377898.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 209 09-26-2011
CpeZ family BL107_08936 ZP_01469890.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 209 09-26-2011
CpeZ family SynWH7803_0488 YP_001224211.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 205 09-26-2011
CpeZ family WH7805_06706 ZP_01123341.1 Synechococcus sp. WH7805 PC+PEI 2 209 09-26-2011
CpeZ family RS9916_40216 ZP_01473086.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 209 09-26-2011
CpeZ family SynRCC307_2052 YP_001228308.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 205 09-26-2011
CpeZ family SCB02_010100004363 ZP_07970142.1 Synechococcus sp. CB0205 PC+PEI 2 204 11-04-2011
CpeZ family S7335_2652 ZP_05036218.1 Synechococcus sp. PCC7335 PC+PEI CA3 209 09-26-2011
CpeZ family Syn8016DRAFT_2750 ZP_08957403.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 204 11-04-2011
CpeZ family NATL1_03871 YP_001014216.1 Prochlorococcus marinus NATL1A PEIII high b/a 198 09-26-2011
CpeZ family PMN2A_1673 YP_292864.1 Prochlorococcus marinus NATL2A PEIII high b/a 198 09-26-2011
CpeZ family Pro0339 NP_874733.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a A block is missing in protomata 202 09-26-2011
CpeZ family P9211_03341 YP_001550219.1 Prochlorococcus marinus MIT9211 PEIII High b/a A block is missing in protomata 200 09-26-2011
CpeZ family P9303_22361 YP_001018236.1 Prochlorococcus sp. MIT9303 PEIII high b/a 210 09-26-2011
CpeZ family PMT1681 NP_895508.1 Prochlorococcus sp. MIT9313 PEIII high b/a 211 09-26-2011
CpeZ family CwatDRAFT_5981 ZP_00514214.1 Crocosphaera watsonii WH8501 PC+PEI 204 09-26-2011
CpeZ family CwatDRAFT_0406 ZP_00518848.1 Crocosphaera watsonii WH8501 PC+PEI Low score, similar to Tery_0980 (IMS101) 219 12-02-2011
CpeZ family PCC7424_5730 YP_002381025.1 Cyanothece sp. PCC7424 PC+PEI 2 201 09-26-2011
CpeZ family PCC8801_4513 YP_002364791.1 Cyanothece sp. PCC8801 PC+PEI 2 208 09-26-2011
CpeZ family Cyan7822_4046 YP_003889246.1 Cyanothece sp. PCC7822 PC+PEI 2 201 09-26-2011
CpeZ family gi|47606673|gb|AAT36319.1| AAT36319.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 205 09-26-2011
CpeZ family gvip157 NP_924133.1 Gloeobacter violaceus PCC7421 PC+PEI 2 204 11-24-2011
CpeZ family GL6909_3531 Gloeothece sp. PCC6909/1 PC+PEI 2 204 06-06-2011
CpeZ family Npun_R3805 YP_001867132.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 202 09-26-2011
CpeZ family Tery_0995 YP_720846.1 Trichodesmium erythraeum IMS101 PC+PEI lower blastp hit on >Tery_0980 203 09-26-2011
CpeZ family Tery_0980 YP_720834.1 Trichodesmium erythraeum IMS101 PC+PEI Blastp hit on cpeZ (but lower than >Tery_0995) 219 09-26-2011
CpeZ family CAJ73184.1| CAJ73184.1 Guillardia theta CCMP2712 Cr-PE 545 n.a. Low protoscan score 229 10-28-2011
CpeZ family LYNGBM3L_56070 ZP_08427728.1 Lyngbya majuscula 3L PC+PEI 2 220 10-19-2011
CpeZ family CWATWH0003_0668 EHJ14660.1 Crocosphaera watsonii WH0003 PC+PEI 204 02-22-2012
CpeZ family CWATWH0003_5315a1 EHJ09924.1 Crocosphaera watsonii WH0003 PC+PEI Incomplete, 2nd copy? 186 02-22-2012
CpeZ family MICAI_2660036 ZP_10228479.1 Microcystis sp. T1-4 PC+PEI 2 203 08-22-2012
CpeZ family SynWH8020_cpeZ AAA27336.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A N-term extended (22 aa added) 208 08-27-2012
CpeZ family Osc7112_1034 YP_007114008.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 204 04-23-2013
CpeZ family Cal6303_1006 YP_007136043.1 Calothrix sp. PCC6303 PC+PEI 2 202 04-29-2013
CpeZ family Osc10802DRAFT_5371 Oscillatoria sp. PCC10802 PC+PEI This sequence has a long N-term which has similarity to C-term end of CpeC (possible sequencing/assembly error) 281 07-02-2013
CpeZ family Ple7327_1946 YP_007080845.1 Pleurocapsa sp. PCC7327 PC+PEI 202 04-23-2013
CpeZ family GLO73106DRAFT_00012690 ZP_21051605.1 Gloeocapsa sp. PCC73106 PC+PEI 204 04-23-2013
CpeZ family Lepto7376_1198 YP_007070389.1 Leptolyngbya sp. PCC7376 PC+PEI 202 04-23-2013
CpeZ family Sta7437_3350 YP_007133822.1 Stanieria cyanosphaera PCC7437 PC+PEI 202 04-29-2013
CpeZ family Xen7305DRAFT_00032340 ZP_21054999.1 Xenococcus sp. PCC7305 PC+PEI 209 04-23-2013
CpeZ family Mic7113_4747 YP_007123826.1 Microcoleus sp. PCC7113 PC+PEI 2 204 04-23-2013
CpeZ family Cha6605_4052 YP_007098535.1 Chamaesiphon minutus PCC6605 PC+PEI 204 04-29-2013
CpeZ family ZP_18907654 ZP_18907654.1 Leptolyngbya sp. PCC7375 PC+PEI 2 205 06-20-2013
CpeZ family Pse7367_3889 YP_007083546.1 Pseudanabaena sp. PCC7367 PC+PEI 206 04-23-2013
PecE family alr0526 NP_484570.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 253 09-26-2011
PecE family Ava_2928 YP_323434.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 253 09-27-2011
PecE family Aazo_0294 YP_003720002.1 Anabaena (Nostoc) azollae 0708 PC+PEC 261 09-26-2011
PecE family FJSC11DRAFT_0798 ZP_08984592.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 257 11-04-2011
PecE family MC7420_3694 ZP_05028438.1 Microcoleus chthonoplastes PCC7420 PC+PEC 260 09-26-2011
PecE family Scytonema_PCC7110_joined_1626 Scytonema hofmanni PCC7110 PC+PEC 258 06-12-2013
PecE family FisPCC73103_3447 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 256 06-12-2013
PecE family FisPCC7414_3837 Fischerella muscicola PCC7414 PC+PEC N-term shortened (35 aa) 257 07-02-2013
PecE family Fischerella_sp._PCC7521_715 Fischerella thermalis PCC7521 PC+PEC 257 06-12-2013
PecE family Chloroglopsis_PCC9212_joined_2978 Chlorogloeopsis sp. PCC9212 PC+PEC 273 06-12-2013
PecE family UYC_06443 Chlorogloeopsis fritschii PCC6912 PC+PEC 273 06-12-2013
PecE family Cal7507_3697 YP_007066922.1 Calothrix sp. PCC7507 PC+PEC 257 04-29-2013
PecE family FIS9605DRAFT_06536 Fischerella sp. PCC9605 PC+PEC 257 06-12-2013
PecE family Fis9431DRAFT_3464 Fischerella sp. PCC9431 PC+PEC 256 06-12-2013
PecE family PCC9339DRAFT_01814 Fischerella sp. PCC9339 PC+PEC 256 06-12-2013
PecE family Nos7524_4171 YP_007077534.1 Nostoc sp. PCC7524 PC+PEC 258 04-23-2013
PecE family Nos7107_3148 YP_007050888.1 Nostoc sp. PCC7107 PC+PEC 256 04-29-2013
PecE family Cylst_0749 YP_007145756.1 Cylindrospermum stagnale PCC7417 PC+PEC 257 04-23-2013
PecE family Anacy_2030 YP_007156420.1 Anabaena cylindrica PCC7122 PC+PEC 260 04-23-2013
PecE family Ana7108_3406 Anabaena sp. PCC7108 PC+PEC 260 06-12-2013
PecE family Riv7116_3567 Rivularia sp. PCC7116 PC+PEC Wrongly marked as pseudo gene in refseq 256 06-20-2013
PecE family Chro_3404 YP_007092732.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 254 04-23-2013
PecE family Lep6406DRAFT_00020410 ZP_21046698.1 Leptolyngbya sp. PCC6406 PC+PEC 260 04-29-2013
PecF family alr0527 NP_484571.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 173 09-26-2011
PecF family Ava_2929 YP_323435.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 213 09-27-2011
PecF family Aazo_0293 YP_003720001.1 Anabaena (Nostoc) azollae 0708 PC+PEC Sequence with an N-term shorter than others (seemingly lacks about 22 otherwise conserved aa) but no obvious problem in genome sequence. The missing N-term contains 3 or 4 His in other strains. 151 08-28-2012
PecF family FJSC11DRAFT_0797 ZP_08984591.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 209 11-04-2011
PecF family MC7420_3606 ZP_05028350.1 Microcoleus chthonoplastes PCC7420 PC+PEC 202 09-26-2011
PecF family Scytonema_PCC7110_joined_1627 Scytonema hofmanni PCC7110 PC+PEC 170 06-12-2013
PecF family FisPCC73103_3446 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 210 06-12-2013
PecF family FisPCC7414_3836 Fischerella muscicola PCC7414 PC+PEC 209 06-12-2013
PecF family Fischerella_sp._PCC7521_716 Fischerella thermalis PCC7521 PC+PEC 209 06-12-2013
PecF family Chloroglopsis_PCC9212_joined_2976 Chlorogloeopsis sp. PCC9212 PC+PEC 209 06-12-2013
PecF family UYC_06441 Chlorogloeopsis fritschii PCC6912 PC+PEC 209 06-12-2013
PecF family Cal7507_3698 YP_007066923.1 Calothrix sp. PCC7507 PC+PEC 212 04-29-2013
PecF family FIS9605DRAFT_06537 Fischerella sp. PCC9605 PC+PEC 210 06-12-2013
PecF family Fis9431DRAFT_3463 Fischerella sp. PCC9431 PC+PEC 210 06-12-2013
PecF family PCC9339DRAFT_01813 Fischerella sp. PCC9339 PC+PEC 210 06-12-2013
PecF family Nos7524_4172 YP_007077535.1 Nostoc sp. PCC7524 PC+PEC 199 04-23-2013
PecF family Nos7107_3147 YP_007050887.1 Nostoc sp. PCC7107 PC+PEC 208 04-29-2013
PecF family Cylst_0750 YP_007145757.1 Cylindrospermum stagnale PCC7417 PC+PEC 215 04-23-2013
PecF family Anacy_2029 YP_007156419.1 Anabaena cylindrica PCC7122 PC+PEC 172 04-23-2013
PecF family Ana7108_3405 Anabaena sp. PCC7108 PC+PEC 151 06-12-2013
PecF family Riv7116_3566 YP_007056565.1 Rivularia sp. PCC7116 PC+PEC 174 04-23-2013
PecF family Chro_3405 YP_007092733.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 208 04-23-2013
PecF family Lep6406DRAFT_00020400 ZP_21046697.1 Leptolyngbya sp. PCC6406 PC+PEC 202 04-29-2013
RpcG family Syncc9605_0418 YP_380749.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 492 09-26-2011
RpcG family SYNW2025 NP_898116.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 466 09-26-2011
RpcG family BL107_08866 ZP_01469876.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 459 09-26-2011
RpcG family RS9916_40131 ZP_01473069.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 467 09-26-2011
RpcG family CwatDRAFT_0661 ZP_00518422.1 Crocosphaera watsonii WH8501 PC+PEI Although this genome also contains rpcE/F genes, WH8501 has been shown that alpha-PC attaches a PUB (Swanson et al. 1991). So the role of rpcE/F genes is unclear. 473 08-30-2012
CpeF family sync_0497 YP_729724.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 301 10-25-2011
CpeF family Syncc9902_1901 YP_377902.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 293 10-25-2011
CpeF family BL107_08916 ZP_01469886.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 308 10-25-2011
CpeF family SynWH7803_0489 YP_001224212.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 298 10-25-2011
CpeF family WH7805_06701 ZP_01123340.1 Synechococcus sp. WH7805 PC+PEI 2 298 10-25-2011
CpeF family RS9916_40196 ZP_01473082.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 297 10-25-2011
CpeF family SynRCC307_2056 YP_001228312.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 304 10-25-2011
CpeF family SCB02_010100004358 ZP_07970141.1 Synechococcus sp. CB0205 PC+PEI 2 MLFPLLV not present in genbank 305 11-04-2011
CpeF family S7335_3548 ZP_05037110.1 Synechococcus sp. PCC7335 PC+PEI CA3 296 10-25-2011
CpeF family S7335_4282 ZP_05037842.1 Synechococcus sp. PCC7335 PC+PEI CA3 Low blast and protomatch score. 332 01-02-2012
CpeF family Syn8016DRAFT_2751 ZP_08957404.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 308 11-04-2011
CpeF family NATL1_03881 YP_001014217.1 Prochlorococcus marinus NATL1A PEIII high b/a 287 10-26-2011
CpeF family PMN2A_1674 YP_292865.1 Prochlorococcus marinus NATL2A PEIII high b/a 287 10-26-2011
CpeF family Pro0340 NP_874734.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 298 10-26-2011
CpeF family P9211_03351 YP_001550220.1 Prochlorococcus marinus MIT9211 PEIII High b/a 285 10-26-2011
CpeF family P9303_22351 YP_001018235.1 Prochlorococcus sp. MIT9303 PEIII high b/a 315 10-26-2011
CpeF family PMT1680 NP_895507.1 Prochlorococcus sp. MIT9313 PEIII high b/a 306 10-26-2011
CpeF family CwatDRAFT_0409 ZP_00518851.1 Crocosphaera watsonii WH8501 PC+PEI 288 10-25-2011
CpeF family PCC7424_5719 YP_002381014.1 Cyanothece sp. PCC7424 PC+PEI 2 299 10-25-2011
CpeF family PCC8801_4511 YP_002364789.1 Cyanothece sp. PCC8801 PC+PEI 2 286 10-25-2011
CpeF family Cyan7822_4029 YP_003889229.1 Cyanothece sp. PCC7822 PC+PEI 2 294 10-25-2011
CpeF family gi|9622258|gb|AAF89697.1| AAF89697.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 303 10-25-2011
CpeF family gll1255 NP_924201.1 Gloeobacter violaceus PCC7421 PC+PEI 2 290 10-25-2011
CpeF family GL6909_3552 Gloeothece sp. PCC6909/1 PC+PEI 2 300 10-25-2011
CpeF family Npun_F3804 YP_001867131.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 300 10-25-2011
CpeF family Tery_0978 YP_720832.1 Trichodesmium erythraeum IMS101 PC+PEI N-term shortened (24 aa removed) 310 08-30-2012
CpeF family Tery_0987 YP_720840.1 Trichodesmium erythraeum IMS101 PC+PEI Best BlastP hit on CpeF (but lower than Tery_0978) 285 08-30-2012
CpeF family LYNGBM3L_55090 ZP_08427735.1 Lyngbya majuscula 3L PC+PEI 2 289 10-28-2011
CpeF family CWATWH0003_5310t4 EHJ09925.1 Crocosphaera watsonii WH0003 PC+PEI incomplete n-term (start of contig) 262 02-22-2012
CpeF family MICAI_2830021 ZP_10228733.1 Microcystis sp. T1-4 PC+PEI 2 309 08-22-2012
CpeF family SynW8020_mpeV AAA27339.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A 301 08-26-2012
CpeF family Osc7112_1017 YP_007113991.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 293 04-24-2013
CpeF family Cal6303_1005 YP_007136042.1 Calothrix sp. PCC6303 PC+PEI 2 302 04-29-2013
CpeF family Cal6303_4952 YP_007139821.1 Calothrix sp. PCC6303 PC+PEI 2 299 04-29-2013
CpeF family Ple7327_1461 YP_007080401.1 Pleurocapsa sp. PCC7327 PC+PEI 304 04-24-2013
CpeF family GLO73106DRAFT_00012620 ZP_21051598.1 Gloeocapsa sp. PCC73106 PC+PEI 284 04-24-2013
CpeF family Lepto7376_4080 YP_007073044.1 Leptolyngbya sp. PCC7376 PC+PEI 300 04-24-2013
CpeF family Sta7437_3852 YP_007134302.1 Stanieria cyanosphaera PCC7437 PC+PEI 295 04-29-2013
CpeF family Xen7305DRAFT_00032330 ZP_21054998.1 Xenococcus sp. PCC7305 PC+PEI 300 04-24-2013
CpeF family Mic7113_4746 YP_007123825.1 Microcoleus sp. PCC7113 PC+PEI 2 303 04-24-2013
CpeF family Cha6605_4057 YP_007098540.1 Chamaesiphon minutus PCC6605 PC+PEI 305 04-29-2013
CpeF family ZP_18907651 ZP_18907651.1 Leptolyngbya sp. PCC7375 PC+PEI 2 303 04-24-2013
CpeF family Pse7367_3917 YP_007083570.1 Pseudanabaena sp. PCC7367 PC+PEI 311 04-24-2013
MpeU family sync_0501 YP_729728.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 291 10-25-2011
MpeU family Syncc9605_0432 YP_380763.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 299 10-25-2011
MpeU family SH8109_0074 ZP_05788568.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 298 10-25-2011
MpeU family SYNW2011 NP_898102.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 301 10-25-2011
MpeU family Syncc9902_1896 YP_377897.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 298 10-25-2011
MpeU family BL107_08941 ZP_01469891.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 298 10-25-2011
MpeU family RS9916_40221 ZP_01473087.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 298 10-25-2011
MpeU family SynRCC307_2051 YP_001228307.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 298 10-25-2011
MpeU family SynWH8020_mpeU AAA27335.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A 297 08-26-2012
MpeW family SH8109_0077 ZP_05790143.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 396 08-28-2012
MpeY family sync_0506 YP_729733.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 398 09-26-2011
MpeY family Syncc9605_0436 YP_380767.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 398 09-26-2011
MpeY family SH8109_0069 ZP_05788234.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 398 11-06-2011
MpeY family SYNW2007 NP_898098.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 398 09-26-2011
MpeY family Syncc9902_1892 YP_377893.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 398 09-26-2011
MpeY family BL107_08961 ZP_01469895.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 400 09-26-2011
MpeY family SynWH7803_0494 YP_001224217.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 397 09-26-2011
MpeY family RS9916_40241 ZP_01473091.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 398 09-26-2011
MpeY family SynRCC307_2047 YP_001228303.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 398 09-26-2011
MpeY family Syn8016DRAFT_2756 ZP_08957409.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 402 11-04-2011
MpeZ family sync_2228 YP_731426.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 409 09-26-2011
MpeZ family Syncc9902_1568 YP_377570.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 409 09-26-2011
MpeZ family BL107_10891 ZP_01469555.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 409 09-26-2011
MpeZ family RS9916_39531 ZP_01472949.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 413 09-26-2011
MpeZ family SynRCC307_2004 YP_001228260.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 414 09-26-2011
IaiH family sync_2351 YP_731548.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 269 10-26-2011
IaiH family Syncc9605_2060 YP_382355.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 270 10-26-2011
IaiH family SH8109_1105 ZP_05789908.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 270 10-26-2011
IaiH family SYNW0621 NP_896714.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 269 10-26-2011
IaiH family Syncc9902_0612 YP_376624.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 270 10-26-2011
IaiH family BL107_16005 ZP_01468434.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 270 10-26-2011
IaiH family SynWH7803_2056 YP_001225779.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 269 10-26-2011
IaiH family WH7805_12348 ZP_01122851.1 Synechococcus sp. WH7805 PC+PEI 2 269 10-26-2011
IaiH family RS9917_08150 ZP_01081220.1 Synechococcus sp. RS9917 PC 1 268 10-26-2011
IaiH family RS9916_34787 ZP_01470988.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 269 10-26-2011
IaiH family WH5701_15416 ZP_01084128.1 Synechococcus sp. WH5701 PC 1 274 10-26-2011
IaiH family SynRCC307_1951 YP_001228207.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 258 10-26-2011
IaiH family SCB01_010100011409 ZP_07974267.1 Synechococcus sp. CB0101 PC 1 266 11-04-2011
IaiH family SCB02_010100005388 ZP_07970337.1 Synechococcus sp. CB0205 PC+PEI 2 MAASPYESPKGSSDLDFDSEL not present in refseq 266 11-04-2011
IaiH family S7335_4906 ZP_05038464.1 Synechococcus sp. PCC7335 PC+PEI CA3 255 10-26-2011
IaiH family SYNPCC7002_A1412 YP_001734659.1 Synechococcus sp. PCC7002 PC 1 246 10-26-2011
IaiH family CPCC7001_263 ZP_05044076.1 Cyanobium sp. PCC7001 PC 1 277 10-26-2011
IaiH family Syn8016DRAFT_2224 ZP_08956879.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 269 11-04-2011
IaiH family PMM1480 NP_893597.1 Prochlorococcus marinus MED4 (CCMP1986/CCMP1378) beta-PEIII low b/a 256 10-26-2011
IaiH family P9515_16601 YP_001011974.1 Prochlorococcus marinus MIT9515 beta-PEIII low b/a 256 10-26-2011
IaiH family P9301_16701 YP_001091894.1 Prochlorococcus marinus MIT9301 beta-PEIII low b/a 255 10-26-2011
IaiH family A9601_16821 YP_001010072.1 Prochlorococcus marinus AS9601 beta-PEIII low b/a 255 10-26-2011
IaiH family P9215_17481 YP_001484947.1 Prochlorococcus marinus MIT9215 beta-PEIII low b/a 255 10-26-2011
IaiH family PMT9312_1573 YP_398069.1 Prochlorococcus marinus MIT9312 beta-PEIII low b/a 255 10-26-2011
IaiH family P9202_32 ZP_05137436.1 Prochlorococcus marinus MIT9202 beta-PEIII low b/a 255 10-26-2011
IaiH family NATL1_18791 YP_001015699.1 Prochlorococcus marinus NATL1A PEIII high b/a 269 10-26-2011
IaiH family PMN2A_1010 YP_292203.1 Prochlorococcus marinus NATL2A PEIII high b/a 269 10-26-2011
IaiH family Pro1634 NP_876025.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 269 10-26-2011
IaiH family P9211_16001 YP_001551485.1 Prochlorococcus marinus MIT9211 PEIII High b/a 269 10-26-2011
IaiH family PUH18301_1815 Prochlorococcus marinus UH18301 beta-PEIII low b/a 255 10-26-2011
IaiH family P9303_04441 YP_001016461.1 Prochlorococcus sp. MIT9303 PEIII high b/a 263 10-26-2011
IaiH family PMT1501 NP_895328.1 Prochlorococcus sp. MIT9313 PEIII high b/a 263 10-26-2011
IaiH family slr1098 NP_440077.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 252 10-26-2011
IaiH family AM1_2319 YP_001516644.1 Acaryochloris marina MBIC11017 (AM1) PC 1 252 10-26-2011
IaiH family alr4537 NP_488577.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 252 10-26-2011
IaiH family Ava_1404 YP_321922.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 252 10-26-2011
IaiH family Aazo_0466 YP_003720123.1 Anabaena (Nostoc) azollae 0708 PC+PEC 254 10-26-2011
IaiH family AmaxDRAFT_1788 ZP_03272970.1 Arthrospira (Spirulina) maxima CS-328 PC 1 261 10-26-2011
IaiH family CwatDRAFT_4428 ZP_00515633.1 Crocosphaera watsonii WH8501 PC+PEI 250 10-26-2011
IaiH family cce_0658 YP_001802075.1 Cyanothece sp. ATCC51142 PC 1 250 10-26-2011
IaiH family PCC7424_2038 YP_002377336.1 Cyanothece sp. PCC7424 PC+PEI 2 246 10-26-2011
IaiH family Cyan7425_0542 YP_002481294.1 Cyanothece sp. PCC7425 PC 1 250 10-26-2011
IaiH family PCC8801_3723 YP_002373834.1 Cyanothece sp. PCC8801 PC+PEI 2 249 10-26-2011
IaiH family Cyan8802_3776 YP_003139418.1 Cyanothece sp. PCC8802 PC 1 249 10-26-2011
IaiH family CY0110_28669 ZP_01730141.1 Cyanothece sp. CCY0110 PC 1 250 10-26-2011
IaiH family Cyan7822_5445 YP_003890596.1 Cyanothece sp. PCC7822 PC+PEI 2 243 10-26-2011
IaiH family FJSC11DRAFT_1220 ZP_08985014.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 252 11-04-2011
IaiH family gll3007 NP_925953.1 Gloeobacter violaceus PCC7421 PC+PEI 2 240 10-26-2011
IaiH family GL6909_0099 Gloeothece sp. PCC6909/1 PC+PEI 2 247 10-26-2011
IaiH family L8106_07506 ZP_01622090.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 N-term extended by FP (New start: complement(37527); stretch added: MEDEKLSVIHSPEAWESPLDH) 247 09-26-2011
IaiH family MC7420_1911 ZP_05025197.1 Microcoleus chthonoplastes PCC7420 PC+PEC 252 10-26-2011
IaiH family MAE_48080 YP_001659822.1 Microcystis aeruginosa NIES-843 PC 1 247 10-26-2011
IaiH family N9414_19727 ZP_01629226.1 Nodularia spumigena CCY9414 PC 1 252 10-26-2011
IaiH family Npun_F4500 YP_001867809.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 252 10-26-2011
IaiH family Synpcc7942_1752 YP_400769.1 Synechococcus elongatus PCC7942 PC 1 250 10-26-2011
IaiH family syc2339_d YP_173049.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 250 10-26-2011
IaiH family CYB_2106 YP_478315.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 242 10-26-2011
IaiH family CYA_0113 YP_473606.1 Synechococcus sp. JA-3-3Ab PC 1 239 10-26-2011
IaiH family tll0329 NP_681119.1 Thermosynechococcus elongatus BP-1 PC 1 251 10-26-2011
IaiH family Tery_4484 YP_723943.1 Trichodesmium erythraeum IMS101 PC+PEI 246 10-26-2011
IaiH family IPF_5485 CAO87094.1 Microcystis aeruginosa PCC7806 PC 1 247 11-02-2011
IaiH family NIES39_Q01300 BAI94138.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 261 11-02-2011
IaiH family MicvaDRAFT_2477 ZP_08493978.1 Microcoleus vaginatus FGP-2 PC 1 248 11-02-2011
IaiH family LYNGBM3L_64630 ZP_08431563.1 Lyngbya majuscula 3L PC+PEI 2 252 11-02-2011
IaiH family OSCI_940010 ZP_07109377.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 248 11-02-2011
IaiH family CRC_00053 ZP_06306749.1 Cylindrospermopsis raciborskii CS-505 PC 1 252 11-02-2011
IaiH family CRD_00800 ZP_06303837.1 Raphidiopsis brookii D9 PC 1 252 11-02-2011
IaiH family PCC_0182 YP_002048842.1 Paulinella chromatophora M0880 PC 1 267 11-02-2011
IaiH family Cy51472DRAFT_2922 ZP_08974126.1 Cyanothece sp. ATCC51472 PC 1 250 01-10-2012
IaiH family ACCM5_010100001232 ZP_09245880.1 Acaryochloris sp. CCMEE5410 APC only 252 01-24-2012
IaiH family AplaP_010100011636 ZP_06382319.1 Arthrospira (Spirulina) platensis Paraca PC 1 261 01-24-2012
IaiH family CWATWH0003_2056 EHJ13243.1 Crocosphaera watsonii WH0003 PC+PEI 250 02-22-2012
IaiH family MICAK_320003 CCI37314.1 Microcystis aeruginosa PCC9701 PC 1 247 08-23-2012
IaiH family MICAG_660025 CCI29018.1 Microcystis aeruginosa PCC9808 PC 1 247 08-22-2012
IaiH family MICAD_2620024 CCI07607.1 Microcystis aeruginosa PCC7941 PC 1 247 08-23-2012
IaiH family MICAC_5470010 CCI04185.1 Microcystis aeruginosa PCC9443 PC 1 247 08-23-2012
IaiH family MICAB_2830008 CCH96991.1 Microcystis aeruginosa PCC9717 PC 1 247 08-23-2012
IaiH family MICCA_1930013 ZP_18816492.1 Microcystis aeruginosa PCC9432 PC 1 247 04-29-2013
IaiH family MICAI_2780007 ZP_10228668.1 Microcystis sp. T1-4 PC+PEI 2 247 08-22-2012
IaiH family Osc7112_4012 YP_007116762.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 248 04-24-2013
IaiH family Scytonema_PCC7110_joined_9529 Scytonema hofmanni PCC7110 PC+PEC 253 06-12-2013
IaiH family FisPCC73103_2012 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 252 06-12-2013
IaiH family FisPCC7414_6969 Fischerella muscicola PCC7414 PC+PEC 252 06-12-2013
IaiH family Fischerella_sp._PCC7521_3782 Fischerella thermalis PCC7521 PC+PEC 252 06-12-2013
IaiH family Chloroglopsis_PCC9212_joined_4547 Chlorogloeopsis sp. PCC9212 PC+PEC 252 06-12-2013
IaiH family UYC_01049 Chlorogloeopsis fritschii PCC6912 PC+PEC 252 06-12-2013
IaiH family Cal6303_5536 YP_007140388.1 Calothrix sp. PCC6303 PC+PEI 2 252 04-29-2013
IaiH family Cal7507_4545 YP_007067746.1 Calothrix sp. PCC7507 PC+PEC 252 04-29-2013
IaiH family Osc10802DRAFT_4729 Oscillatoria sp. PCC10802 PC+PEI 248 06-12-2013
IaiH family Oscil6304_5734 YP_007089129.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 247 04-29-2013
IaiH family FIS9605DRAFT_00906 Fischerella sp. PCC9605 PC+PEC 252 06-12-2013
IaiH family Fis9431DRAFT_3532 Fischerella sp. PCC9431 PC+PEC 252 06-12-2013
IaiH family PCC9339DRAFT_01656 Fischerella sp. PCC9339 PC+PEC 252 06-12-2013
IaiH family Nos7524_2481 YP_007075918.1 Nostoc sp. PCC7524 PC+PEC 252 04-24-2013
IaiH family Nos7107_5208 YP_007052867.1 Nostoc sp. PCC7107 PC+PEC 252 04-29-2013
IaiH family Cylst_1364 YP_007146333.1 Cylindrospermum stagnale PCC7417 PC+PEC 252 04-24-2013
IaiH family Anacy_4866 YP_007159119.1 Anabaena cylindrica PCC7122 PC+PEC 252 04-24-2013
IaiH family Ana7108_4503 Anabaena sp. PCC7108 PC+PEC 252 06-12-2013
IaiH family Riv7116_2387 YP_007055450.1 Rivularia sp. PCC7116 PC+PEC 252 04-24-2013
IaiH family Syn7509DRAFT_00026090 ZP_21040934.1 Synechocystis sp. PCC7509 PC 252 04-24-2013
IaiH family Glo7428_1948 YP_007127656.1 Gloeocapsa sp. PCC7428 PC 253 04-24-2013
IaiH family Chro_4094 YP_007093367.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 252 04-24-2013
IaiH family Dacsa_2567 YP_007172513.1 Dactylococcopsis salina PCC8305 253 04-24-2013
IaiH family PCC7418_1206 YP_007167622.1 Halothece sp. PCC7418 PC 264 04-24-2013
IaiH family Ple7327_4580 YP_007083233.1 Pleurocapsa sp. PCC7327 PC+PEI 252 04-24-2013
IaiH family GLO73106DRAFT_00021120 ZP_21050727.1 Gloeocapsa sp. PCC73106 PC+PEI 251 04-24-2013
IaiH family Lepto7376_3254 YP_007072316.1 Leptolyngbya sp. PCC7376 PC+PEI 246 04-24-2013
IaiH family Cyast_1343 YP_007164957.1 Cyanobacterium stanieri PCC7202 PC 247 04-24-2013
IaiH family Cyan10605_1845 YP_007161991.1 Cyanobacterium aponimum PCC10605 248 04-29-2013
IaiH family Sta7437_0351 YP_007130929.1 Stanieria cyanosphaera PCC7437 PC+PEI 252 04-29-2013
IaiH family Xen7305DRAFT_00003450 ZP_21057788.1 Xenococcus sp. PCC7305 PC+PEI 254 04-24-2013
IaiH family Mic7113_3327 YP_007122465.1 Microcoleus sp. PCC7113 PC+PEI 2 252 04-24-2013
IaiH family Cri9333_0885 YP_007141311.1 Crinalium epipsammum PCC9333 PC 252 04-29-2013
IaiH family Cha6605_0246 YP_007095075.1 Chamaesiphon minutus PCC6605 PC+PEI 257 04-29-2013
IaiH family Cyagr_3038 YP_007047461.1 Cyanobium gracile PCC6307 PC 266 04-29-2013
IaiH family Lep6406DRAFT_00001360 ZP_21048597.1 Leptolyngbya sp. PCC6406 PC+PEC 260 04-29-2013
IaiH family ZP_18908495 ZP_18908495.1 Leptolyngbya sp. PCC7375 PC+PEI 2 251 04-24-2013
IaiH family GEI7407_1580 YP_007109123.1 Geitlerinema sp. PCC7407 PC 250 04-29-2013
IaiH family LepboDRAFT_3635 Leptolyngbya boryana PCC6306 PC 251 06-11-2013
IaiH family Syn6312_3460 YP_007063030.1 Synechococcus sp. PCC6312 PC 249 04-29-2013
IaiH family Syn7502_01130 YP_007105374.1 Synechococcus sp. PCC7502 PC 263 04-29-2013
IaiH family Pse7429DRAFT_0263 ZP_21064643.1 Pseudanabaena sp. (biceps) PCC7429 PC 253 04-24-2013
IaiH family Pse7367_0988 YP_007101715.1 Pseudanabaena sp. PCC7367 PC+PEI 248 04-24-2013
IaiH family ZP_20932525 ZP_20932525.1 Microcystis aeruginosa TAIHU98 PC 1 247 04-24-2013
L8106_11777 homologs family AmaxDRAFT_5407 ZP_03276581.1 Arthrospira (Spirulina) maxima CS-328 PC 1 292 12-01-2011
L8106_11777 homologs family L8106_11777 ZP_01621519.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 316 09-26-2011
L8106_11777 homologs family NIES39_O04890 BAI93736.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 314 12-01-2011
L8106_11777 homologs family AplaP_010100002137 ZP_06380464.1 Arthrospira (Spirulina) platensis Paraca PC 1 Incomplete n-term (end of contig). Almost identical to homologs in other Arthrospira species. 179 08-27-2012
L8106_16949 homologs family S7335_5516 ZP_05039071.1 Synechococcus sp. PCC7335 PC+PEI CA3 439 12-05-2011
L8106_16949 homologs family SYNPCC7002_A1619 YP_001734865.1 Synechococcus sp. PCC7002 PC 1 393 12-05-2011
L8106_16949 homologs family AM1_2983 YP_001517295.1 Acaryochloris marina MBIC11017 (AM1) PC 1 395 12-05-2011
L8106_16949 homologs family all0605 NP_484649.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 398 12-05-2011
L8106_16949 homologs family Ava_4537 YP_325030.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 400 12-05-2011
L8106_16949 homologs family AmaxDRAFT_3716 ZP_03274892.1 Arthrospira (Spirulina) maxima CS-328 PC 1 414 12-05-2011
L8106_16949 homologs family CwatDRAFT_4661 ZP_00515205.1 Crocosphaera watsonii WH8501 PC+PEI 377 12-05-2011
L8106_16949 homologs family cce_2919 YP_001804333.1 Cyanothece sp. ATCC51142 PC 1 377 12-05-2011
L8106_16949 homologs family PCC7424_1681 YP_002376985.1 Cyanothece sp. PCC7424 PC+PEI 2 388 12-05-2011
L8106_16949 homologs family PCC8801_2470 YP_002372635.1 Cyanothece sp. PCC8801 PC+PEI 2 395 12-05-2011
L8106_16949 homologs family Cyan8802_3638 YP_003139288.1 Cyanothece sp. PCC8802 PC 1 395 12-05-2011
L8106_16949 homologs family CY0110_30523 ZP_01730379.1 Cyanothece sp. CCY0110 PC 1 381 12-05-2011
L8106_16949 homologs family Cyan7822_3567 YP_003888783.1 Cyanothece sp. PCC7822 PC+PEI 2 391 12-05-2011
L8106_16949 homologs family FJSC11DRAFT_0884 ZP_08984678.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 404 12-05-2011
L8106_16949 homologs family GL6909_2003 Gloeothece sp. PCC6909/1 PC+PEI 2 366 12-05-2011
L8106_16949 homologs family L8106_16949 ZP_01620421.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 419 09-26-2011
L8106_16949 homologs family MC7420_2776 ZP_05030778.1 Microcoleus chthonoplastes PCC7420 PC+PEC 398 12-05-2011
L8106_16949 homologs family MAE_60750 YP_001661089.1 Microcystis aeruginosa NIES-843 PC 1 396 12-05-2011
L8106_16949 homologs family N9414_05274 ZP_01629849.1 Nodularia spumigena CCY9414 PC 1 437 12-05-2011
L8106_16949 homologs family Npun_F1530 YP_001865162.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 432 06-12-2013
L8106_16949 homologs family Tery_0072 YP_720054.1 Trichodesmium erythraeum IMS101 PC+PEI 442 12-05-2011
L8106_16949 homologs family IPF_2545 CAO87418.1 Microcystis aeruginosa PCC7806 PC 1 396 12-05-2011
L8106_16949 homologs family NIES39_H00170 BAI90942.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 410 12-05-2011
L8106_16949 homologs family MicvaDRAFT_3571 ZP_08493473.1 Microcoleus vaginatus FGP-2 PC 1 430 12-05-2011
L8106_16949 homologs family LYNGBM3L_62310 ZP_08431195.1 Lyngbya majuscula 3L PC+PEI 2 397 12-05-2011
L8106_16949 homologs family OSCI_1070009 ZP_07109619.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 452 12-05-2011
L8106_16949 homologs family Cy51472DRAFT_4412 ZP_08975615.1 Cyanothece sp. ATCC51472 PC 1 377 01-10-2012
L8106_16949 homologs family ACCM5_010100005086 ZP_09246638.1 Acaryochloris sp. CCMEE5410 APC only 395 01-24-2012
L8106_16949 homologs family AplaP_010100015438 ZP_06383071.1 Arthrospira (Spirulina) platensis Paraca PC 1 410 01-24-2012
L8106_16949 homologs family CWATWH0003_1645 EHJ13671.1 Crocosphaera watsonii WH0003 PC+PEI 377 02-22-2012
L8106_16949 homologs family MICAK_1050005 CCI34771.1 Microcystis aeruginosa PCC9701 PC 1 396 08-23-2012
L8106_16949 homologs family MICAG_840013 CCI29493.1 Microcystis aeruginosa PCC9808 PC 1 396 08-22-2012
L8106_16949 homologs family MICAD_840005 CCI09780.1 Microcystis aeruginosa PCC7941 PC 1 396 08-23-2012
L8106_16949 homologs family MICAC_4580012 CCI03406.1 Microcystis aeruginosa PCC9443 PC 1 396 08-23-2012
L8106_16949 homologs family MICAB_5340001 CCH98773.1 Microcystis aeruginosa PCC9717 PC 1 396 08-23-2012
L8106_16949 homologs family MICCA_3420010 ZP_18818233.1 Microcystis aeruginosa PCC9432 PC 1 396 04-29-2013
L8106_16949 homologs family MICAI_840009 ZP_10230413.1 Microcystis sp. T1-4 PC+PEI 2 396 08-22-2012
L8106_16949 homologs family Osc7112_1244 YP_007114204.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 438 04-24-2013
L8106_16949 homologs family Scytonema_PCC7110_joined_8104 Scytonema hofmanni PCC7110 PC+PEC 429 06-12-2013
L8106_16949 homologs family FisPCC73103_4572 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 364 06-12-2013
L8106_16949 homologs family FisPCC7414_5095 Fischerella muscicola PCC7414 PC+PEC 404 06-12-2013
L8106_16949 homologs family Fischerella_sp._PCC7521_613 Fischerella thermalis PCC7521 PC+PEC 404 06-12-2013
L8106_16949 homologs family Chloroglopsis_PCC9212_joined_5948 Chlorogloeopsis sp. PCC9212 PC+PEC 432 06-12-2013
L8106_16949 homologs family UYC_03057 Chlorogloeopsis fritschii PCC6912 PC+PEC 432 06-12-2013
L8106_16949 homologs family Cal7507_2105 YP_007065381.1 Calothrix sp. PCC7507 PC+PEC 433 04-29-2013
L8106_16949 homologs family Osc10802DRAFT_0992 Oscillatoria sp. PCC10802 PC+PEI 437 06-12-2013
L8106_16949 homologs family Oscil6304_0495 YP_007084161.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 482 04-29-2013
L8106_16949 homologs family FIS9605DRAFT_00990 Fischerella sp. PCC9605 PC+PEC 417 06-12-2013
L8106_16949 homologs family Fis9431DRAFT_4372 Fischerella sp. PCC9431 PC+PEC 364 06-12-2013
L8106_16949 homologs family PCC9339DRAFT_01500 Fischerella sp. PCC9339 PC+PEC 364 06-12-2013
L8106_16949 homologs family Nos7524_4345 YP_007077701.1 Nostoc sp. PCC7524 PC+PEC 395 04-24-2013
L8106_16949 homologs family Nos7107_2254 YP_007050016.1 Nostoc sp. PCC7107 PC+PEC 396 04-29-2013
L8106_16949 homologs family Riv7116_0550 YP_007053692.1 Rivularia sp. PCC7116 PC+PEC 401 04-24-2013
L8106_16949 homologs family Syn7509DRAFT_00026430 ZP_21040968.1 Synechocystis sp. PCC7509 PC 429 04-24-2013
L8106_16949 homologs family Glo7428_1959 YP_007127666.1 Gloeocapsa sp. PCC7428 PC 435 04-24-2013
L8106_16949 homologs family Chro_3567 YP_007092891.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 464 04-24-2013
L8106_16949 homologs family Ple7327_1571 YP_007080500.1 Pleurocapsa sp. PCC7327 PC+PEI 417 04-24-2013
L8106_16949 homologs family Lepto7376_4351 YP_007073293.1 Leptolyngbya sp. PCC7376 PC+PEI 389 04-24-2013
L8106_16949 homologs family Xen7305DRAFT_00042220 ZP_21054004.1 Xenococcus sp. PCC7305 PC+PEI 412 04-24-2013
L8106_16949 homologs family Mic7113_0135 YP_007119479.1 Microcoleus sp. PCC7113 PC+PEI 2 434 04-24-2013
L8106_16949 homologs family Cri9333_2973 YP_007143322.1 Crinalium epipsammum PCC9333 PC 429 04-29-2013
L8106_16949 homologs family Cha6605_0750 YP_007095548.1 Chamaesiphon minutus PCC6605 PC+PEI 451 04-29-2013
L8106_16949 homologs family LepboDRAFT_3472 Leptolyngbya boryana PCC6306 PC 425 06-11-2013
L8106_16949 homologs family Pse7367_2344 YP_007103033.1 Pseudanabaena sp. PCC7367 PC+PEI 423 04-24-2013
L8106_16949 homologs family ZP_20933301 ZP_20933301.1 Microcystis aeruginosa TAIHU98 PC 1 396 04-24-2013
L8106_22089 homologs family all3549+all3550 NP_487589.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC frameshift (or sequencing error) in all3550 389 01-10-2012
L8106_22089 homologs family Ava_3528 YP_324030.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 389 12-06-2011
L8106_22089 homologs family Aazo_5152 YP_003723334.1 Anabaena (Nostoc) azollae 0708 PC+PEC 358 12-06-2011
L8106_22089 homologs family AmaxDRAFT_0777 ZP_03271959.1 Arthrospira (Spirulina) maxima CS-328 PC 1 334 12-06-2011
L8106_22089 homologs family CwatDRAFT_0171 ZP_00519405.1 Crocosphaera watsonii WH8501 PC+PEI split between 3 different contigs: ZP_00517336.1 (CwatDRAFT_2581), ZP_00513741.1 (CwatDRAFT_6637) and ZP_00519405.1 (CwatDRAFT_0171) 107 08-29-2012
L8106_22089 homologs family cce_2926 YP_001804340.1 Cyanothece sp. ATCC51142 PC 1 391 12-06-2011
L8106_22089 homologs family PCC8801_0696 YP_002370937.1 Cyanothece sp. PCC8801 PC+PEI 2 392 12-06-2011
L8106_22089 homologs family Cyan8802_0724 YP_003136498.1 Cyanothece sp. PCC8802 PC 1 392 12-06-2011
L8106_22089 homologs family CY0110_02889 ZP_01727378.1 Cyanothece sp. CCY0110 PC 1 394 12-06-2011
L8106_22089 homologs family Cyan7822_4402 YP_003889591.1 Cyanothece sp. PCC7822 PC+PEI 2 388 12-06-2011
L8106_22089 homologs family FJSC11DRAFT_4556 ZP_08988348.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 333 12-06-2011
L8106_22089 homologs family GL6909_1567 Gloeothece sp. PCC6909/1 PC+PEI 2 373 12-06-2011
L8106_22089 homologs family L8106_22089 ZP_01623387.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 314 09-26-2011
L8106_22089 homologs family MC7420_2176 ZP_05026788.1 Microcoleus chthonoplastes PCC7420 PC+PEC 417 12-06-2011
L8106_22089 homologs family MAE_36470 YP_001658661.1 Microcystis aeruginosa NIES-843 PC 1 N-term shortened (18 aa removed) 364 08-28-2012
L8106_22089 homologs family N9414_18048 ZP_01631680.1 Nodularia spumigena CCY9414 PC 1 394 12-06-2011
L8106_22089 homologs family Npun_R4663 YP_001867963.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 380 12-06-2011
L8106_22089 homologs family Tery_5007 YP_724393.1 Trichodesmium erythraeum IMS101 PC+PEI 398 12-06-2011
L8106_22089 homologs family IPF_5551 CAO86824.1 Microcystis aeruginosa PCC7806 PC 1 Incomplete sequence. Another chunk is in IPF_6118 (CAO87604.1) 325 01-10-2012
L8106_22089 homologs family IPF_6118 CAO87604.1 Microcystis aeruginosa PCC7806 PC 1 Shorter than other L8106_22089 homologs 251 04-24-2013
L8106_22089 homologs family NIES39_A07090 BAI88547.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 360 12-06-2011
L8106_22089 homologs family MicvaDRAFT_5105 ZP_08494867.1 Microcoleus vaginatus FGP-2 PC 1 397 12-06-2011
L8106_22089 homologs family LYNGBM3L_34780 ZP_08427350.1 Lyngbya majuscula 3L PC+PEI 2 422 12-06-2011
L8106_22089 homologs family OSCI_2990020 ZP_07111171.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 429 12-06-2011
L8106_22089 homologs family Cy51472DRAFT_4419 ZP_08975622.1 Cyanothece sp. ATCC51472 PC 1 391 01-10-2012
L8106_22089 homologs family AplaP_010100006555 ZP_06381327.1 Arthrospira (Spirulina) platensis Paraca PC 1 332 01-24-2012
L8106_22089 homologs family MICAK_1200005 CCI34961.1 Microcystis aeruginosa PCC9701 PC 1 367 08-23-2012
L8106_22089 homologs family MICAG_1620006 CCI22083.1 Microcystis aeruginosa PCC9808 PC 1 367 08-22-2012
L8106_22089 homologs family MICAD_1710014 CCI06343.1 Microcystis aeruginosa PCC7941 PC 1 367 08-23-2012
L8106_22089 homologs family MICAC_1420008 CCI00959.1 Microcystis aeruginosa PCC9443 PC 1 366 08-23-2012
L8106_22089 homologs family MICAB_4560020 CCH98232.1 Microcystis aeruginosa PCC9717 PC 1 364 08-23-2012
L8106_22089 homologs family MICCA_2560018 ZP_18817326.1 Microcystis aeruginosa PCC9432 PC 1 367 04-29-2013
L8106_22089 homologs family MICAI_2510011 ZP_10228186.1 Microcystis sp. T1-4 PC+PEI 2 364 08-22-2012
L8106_22089 homologs family Osc7112_4556 YP_007117267.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 397 04-24-2013
L8106_22089 homologs family Scytonema_PCC7110_joined_4761 Scytonema hofmanni PCC7110 PC+PEC 389 06-12-2013
L8106_22089 homologs family FisPCC73103_2341 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 297 06-12-2013
L8106_22089 homologs family FisPCC7414_5280 Fischerella muscicola PCC7414 PC+PEC 334 06-12-2013
L8106_22089 homologs family Fischerella_sp._PCC7521_2408 Fischerella thermalis PCC7521 PC+PEC 281 06-12-2013
L8106_22089 homologs family Chloroglopsis_PCC9212_joined_1928 Chlorogloeopsis sp. PCC9212 PC+PEC 381 06-12-2013
L8106_22089 homologs family UYC_02940 Chlorogloeopsis fritschii PCC6912 PC+PEC 381 06-12-2013
L8106_22089 homologs family Cal6303_4175 YP_007139061.1 Calothrix sp. PCC6303 PC+PEI 2 394 04-29-2013
L8106_22089 homologs family Cal7507_4899 YP_007068086.1 Calothrix sp. PCC7507 PC+PEC 371 04-29-2013
L8106_22089 homologs family Osc10802DRAFT_2033 Oscillatoria sp. PCC10802 PC+PEI 376 06-12-2013
L8106_22089 homologs family FIS9605DRAFT_01162 Fischerella sp. PCC9605 PC+PEC 378 06-12-2013
L8106_22089 homologs family Fis9431DRAFT_1567 Fischerella sp. PCC9431 PC+PEC 333 06-12-2013
L8106_22089 homologs family PCC9339DRAFT_04646 Fischerella sp. PCC9339 PC+PEC 335 06-12-2013
L8106_22089 homologs family Nos7524_5290 YP_007078610.1 Nostoc sp. PCC7524 PC+PEC 394 04-24-2013
L8106_22089 homologs family Nos7107_0871 YP_007048687.1 Nostoc sp. PCC7107 PC+PEC 399 04-29-2013
L8106_22089 homologs family Cylst_6105 YP_007150756.1 Cylindrospermum stagnale PCC7417 PC+PEC 391 04-24-2013
L8106_22089 homologs family Anacy_5157 YP_007159401.1 Anabaena cylindrica PCC7122 PC+PEC 385 04-24-2013
L8106_22089 homologs family Ana7108_3306 Anabaena sp. PCC7108 PC+PEC 388 06-12-2013
L8106_22089 homologs family Riv7116_5847 YP_007058758.1 Rivularia sp. PCC7116 PC+PEC 369 04-24-2013
L8106_22089 homologs family Ple7327_1958 YP_007080856.1 Pleurocapsa sp. PCC7327 PC+PEI 366 04-24-2013
L8106_22089 homologs family GEI7407_1102 YP_007108651.1 Geitlerinema sp. PCC7407 PC 451 04-29-2013
L8106_22089 homologs family LepboDRAFT_2621 Leptolyngbya boryana PCC6306 PC 322 06-11-2013
L8106_22089 homologs family ZP_20934303 ZP_20934303.1 Microcystis aeruginosa TAIHU98 PC 1 367 04-24-2013
MC7420_3535 homologs family alr1903 NP_485943.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 1547 12-05-2011
MC7420_3535 homologs family all3465 NP_487505.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 1119 12-06-2011
MC7420_3535 homologs family all3892 NP_487932.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 874 12-06-2011
MC7420_3535 homologs family alr2986 NP_487026.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 885 12-07-2011
MC7420_3535 homologs family Ava_3508 YP_324010.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 1148 12-06-2011
MC7420_3535 homologs family AmaxDRAFT_1081 ZP_03272263.1 Arthrospira (Spirulina) maxima CS-328 PC 1 1093 12-06-2011
MC7420_3535 homologs family AmaxDRAFT_0188 ZP_03271372.1 Arthrospira (Spirulina) maxima CS-328 PC 1 786 12-07-2011
MC7420_3535 homologs family PCC7424_1133 YP_002376452.1 Cyanothece sp. PCC7424 PC+PEI 2 951 12-06-2011
MC7420_3535 homologs family PCC7424_1763 YP_002377065.1 Cyanothece sp. PCC7424 PC+PEI 2 1475 12-07-2011
MC7420_3535 homologs family PCC8801_0753 YP_002370992.1 Cyanothece sp. PCC8801 PC+PEI 2 838 12-07-2011
MC7420_3535 homologs family Cyan7822_4279 YP_003889472.1 Cyanothece sp. PCC7822 PC+PEI 2 1244 12-05-2011
MC7420_3535 homologs family L8106_24365 ZP_01619849.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 1044 12-07-2011
MC7420_3535 homologs family MC7420_3535 ZP_05029509.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1322 12-05-2011
MC7420_3535 homologs family MC7420_6333 ZP_05026152.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1184 12-06-2011
MC7420_3535 homologs family MC7420_6677 ZP_05028167.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1432 12-06-2011
MC7420_3535 homologs family MC7420_6046 ZP_05027237.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1260 12-06-2011
MC7420_3535 homologs family MC7420_4498 ZP_05028866.1 Microcoleus chthonoplastes PCC7420 PC+PEC 923 12-06-2011
MC7420_3535 homologs family MC7420_2915 ZP_05024179.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1355 12-07-2011
MC7420_3535 homologs family MAE_07890 YP_001655803.1 Microcystis aeruginosa NIES-843 PC 1 890 12-06-2011
MC7420_3535 homologs family N9414_03573 ZP_01630825.1 Nodularia spumigena CCY9414 PC 1 1285 12-05-2011
MC7420_3535 homologs family N9414_06844 ZP_01628936.1 Nodularia spumigena CCY9414 PC 1 936 12-06-2011
MC7420_3535 homologs family Tery_1841 YP_721570.1 Trichodesmium erythraeum IMS101 PC+PEI 1343 12-05-2011
MC7420_3535 homologs family Tery_0826 YP_720713.1 Trichodesmium erythraeum IMS101 PC+PEI 1328 12-06-2011
MC7420_3535 homologs family IPF_2632 CAO90937.1 Microcystis aeruginosa PCC7806 PC 1 1500 12-05-2011
MC7420_3535 homologs family IPF_2635 CAO90934.1 Microcystis aeruginosa PCC7806 PC 1 Much shorter than other MC7420_3535 homologs 263 12-07-2011
MC7420_3535 homologs family NIES39_J02930 BAI91340.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 1219 01-10-2012
MC7420_3535 homologs family NIES39_K01090 BAI91758.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 892 12-06-2011
MC7420_3535 homologs family ZP_08491193.1 ZP_08491193.1 Microcoleus vaginatus FGP-2 PC 1 1179 12-05-2011
MC7420_3535 homologs family MicvaDRAFT_0024 ZP_08495704.1 Microcoleus vaginatus FGP-2 PC 1 981 12-06-2011
MC7420_3535 homologs family LYNGBM3L_29440 ZP_08428664.1 Lyngbya majuscula 3L PC+PEI 2 1405 12-05-2011
MC7420_3535 homologs family LYNGBM3L_30460 ZP_08428879.1 Lyngbya majuscula 3L PC+PEI 2 1365 12-06-2011
MC7420_3535 homologs family LYNGBM3L_55810 ZP_08427827.1 Lyngbya majuscula 3L PC+PEI 2 1106 12-06-2011
MC7420_3535 homologs family LYNGBM3L_00970 ZP_08427981.1 Lyngbya majuscula 3L PC+PEI 2 1139 12-06-2011
MC7420_3535 homologs family LYNGBM3L_75690 ZP_08427936.1 Lyngbya majuscula 3L PC+PEI 2 1108 12-06-2011
MC7420_3535 homologs family LYNGBM3L_40770 ZP_08429450.1 Lyngbya majuscula 3L PC+PEI 2 1273 12-07-2011
MC7420_3535 homologs family OSCI_180019 ZP_07108594.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 1008 12-06-2011
MC7420_3535 homologs family OSCI_440025 ZP_07108865.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 992 12-07-2011
MC7420_4701 homologs family Cyan7822_1857 YP_003887117.1 Cyanothece sp. PCC7822 PC+PEI 2 457 11-30-2011
MC7420_4701 homologs family MC7420_4701 ZP_05025511.1 Microcoleus chthonoplastes PCC7420 PC+PEC 455 11-30-2011
MC7420_4701 homologs family MC7420_1061 ZP_05028540.1 Microcoleus chthonoplastes PCC7420 PC+PEC This sequence has a much shorter N-term than others. But not a frameshift. 173 09-11-2012
MC7420_4701 homologs family MicvaDRAFT_1724 ZP_08491624.1 Microcoleus vaginatus FGP-2 PC 1 Sequence shortened at N-term (104 aa removed: MNSAATLIQQLPELSDAQFHQKYLKQKQGMRTLATILPQVEQQSLALRAVKLALKVNLKLGSKLAGTVKPEFQIATIKLIEKIPTSPLLKIQLLALTSSDMAIP) 534 09-11-2012
MC7420_4701 homologs family Osc7112_2212 YP_007115088.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 638 04-24-2013
MC7420_4701 homologs family Osc10802DRAFT_3523 Oscillatoria sp. PCC10802 PC+PEI 550 06-12-2013
CotB family S7335_4506 ZP_05038065.1 Synechococcus sp. PCC7335 PC+PEI CA3 220 09-26-2011
CotB family CwatDRAFT_1185 ZP_00517831.1 Crocosphaera watsonii WH8501 PC+PEI 218 09-26-2011
CotB family PCC7424_5727 YP_002381022.1 Cyanothece sp. PCC7424 PC+PEI 2 218 09-26-2011
CotB family PCC7424_1391 YP_002376703.1 Cyanothece sp. PCC7424 PC+PEI 2 219 09-26-2011
CotB family Cyan7425_3035 YP_002483730.1 Cyanothece sp. PCC7425 PC 1 222 09-26-2011
CotB family Cyan7822_0127 YP_003885453.1 Cyanothece sp. PCC7822 PC+PEI 2 219 09-26-2011
CotB family Cyan7822_4037 YP_003889237.1 Cyanothece sp. PCC7822 PC+PEI 2 220 09-26-2011
CotB family gi|33090216|gb|AAP93903.1| AAP93903.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 219 09-26-2011
CotB family gvip178 NP_924203.1 Gloeobacter violaceus PCC7421 PC+PEI 2 217 11-24-2011
CotB family GL6909_0631 Gloeothece sp. PCC6909/1 PC+PEI 2 219 08-30-2011
CotB family GL6909_3542 Gloeothece sp. PCC6909/1 PC+PEI 2 218 11-24-2011
CotB family Npun_R0734 YP_001864429.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 220 09-26-2011
CotB family Tery_2382 YP_722075.1 Trichodesmium erythraeum IMS101 PC+PEI N-term shortened (15 aa removed: MLVYVKKGKQNSQII) 219 09-26-2011
CotB family MicvaDRAFT_0237 ZP_08495395.1 Microcoleus vaginatus FGP-2 PC 1 218 10-28-2011
CotB family LYNGBM3L_16600 ZP_08428239.1 Lyngbya majuscula 3L PC+PEI 2 218 10-28-2011
CotB family CWATWH0003_4320 EHJ10938.1 Crocosphaera watsonii WH0003 PC+PEI 218 02-22-2012
CotB family Osc7112_1071 YP_007114038.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 218 04-24-2013
CotB family Osc7112_1024 YP_007113998.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 218 04-24-2013
CotB family Cal6303_3397 YP_007138304.1 Calothrix sp. PCC6303 PC+PEI 2 219 04-29-2013
CotB family Osc10802DRAFT_2573 Oscillatoria sp. PCC10802 PC+PEI 218 06-12-2013
CotB family Ple7327_3416 YP_007082181.1 Pleurocapsa sp. PCC7327 PC+PEI 218 04-24-2013
CotB family Sta7437_3034 YP_007133518.1 Stanieria cyanosphaera PCC7437 PC+PEI 218 04-29-2013
CotB family Xen7305DRAFT_00028590 ZP_21055352.1 Xenococcus sp. PCC7305 PC+PEI 218 04-24-2013
CotB family Mic7113_4739 YP_007123818.1 Microcoleus sp. PCC7113 PC+PEI 2 227 04-24-2013
CotB homologs 1 family sync_0128 YP_729365.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 208 09-26-2011
CotB homologs 1 family Syncc9605_0122 YP_380453.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 204 09-26-2011
CotB homologs 1 family SH8109_0378 ZP_05790768.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 204 09-26-2011
CotB homologs 1 family SYNW0139 NP_896234.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 205 09-26-2011
CotB homologs 1 family Syncc9902_0166 YP_376184.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 203 09-26-2011
CotB homologs 1 family BL107_05959 ZP_01468938.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 203 09-26-2011
CotB homologs 1 family SynWH7803_0189 YP_001223912.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 208 09-26-2011
CotB homologs 1 family WH7805_08566 ZP_01123713.1 Synechococcus sp. WH7805 PC+PEI 2 208 09-26-2011
CotB homologs 1 family RS9917_05100 ZP_01079060.1 Synechococcus sp. RS9917 PC 1 211 09-26-2011
CotB homologs 1 family RS9916_38227 ZP_01471676.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 207 09-26-2011
CotB homologs 1 family WH5701_01640 ZP_01084821.1 Synechococcus sp. WH5701 PC 1 210 09-26-2011
CotB homologs 1 family SynRCC307_0128 YP_001226384.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 177 12-05-2011
CotB homologs 1 family SCB01_010100014119 ZP_07974801.1 Synechococcus sp. CB0101 PC 1 196 11-04-2011
CotB homologs 1 family SCB02_010100002826 ZP_07969839.1 Synechococcus sp. CB0205 PC+PEI 2 193 05-24-2012
CotB homologs 1 family CPCC7001_2625 ZP_05046435.1 Cyanobium sp. PCC7001 PC 1 215 09-26-2011
CotB homologs 1 family Syn8016DRAFT_1730 ZP_08956385.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 208 11-04-2011
CotB homologs 1 family Cyan7425_3615 YP_002484296.1 Cyanothece sp. PCC7425 PC 1 221 09-26-2011
CotB homologs 1 family Synpcc7942_2325 YP_401342.1 Synechococcus elongatus PCC7942 PC 1 N-term shortened (30 aa removed : MASAIAKLSAAPASVTPCGSVKDERLSCAS) 225 08-28-2012
CotB homologs 1 family syc1777_d YP_172487.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 225 09-26-2011
CotB homologs 1 family Cyagr_2203 YP_007046657.1 Cyanobium gracile PCC6307 PC 199 04-29-2013
CotB homologs 2 family S7335_3847 ZP_05037409.1 Synechococcus sp. PCC7335 PC+PEI CA3 227 11-24-2011
CotB homologs 2 family SYNPCC7002_A1440 YP_001734687.1 Synechococcus sp. PCC7002 PC 1 222 09-26-2011
CotB homologs 2 family slr1687 NP_441698.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 223 09-26-2011
CotB homologs 2 family AM1_0043 YP_001514445.1 Acaryochloris marina MBIC11017 (AM1) PC 1 221 09-26-2011
CotB homologs 2 family alr0616 NP_484660.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 226 09-26-2011
CotB homologs 2 family Ava_4548 YP_325041.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 226 09-27-2011
CotB homologs 2 family AmaxDRAFT_5534 ZP_03276708.1 Arthrospira (Spirulina) maxima CS-328 PC 1 6 aa missing on N-term (start scaffold) 217 09-26-2011
CotB homologs 2 family CwatDRAFT_4214 ZP_00515817.1 Crocosphaera watsonii WH8501 PC+PEI 223 11-24-2011
CotB homologs 2 family cce_3774 YP_001805188.1 Cyanothece sp. ATCC51142 PC 1 223 09-26-2011
CotB homologs 2 family PCC7424_0572 YP_002375902.1 Cyanothece sp. PCC7424 PC+PEI 2 223 09-26-2011
CotB homologs 2 family Cyan7425_1323 YP_002482061.1 Cyanothece sp. PCC7425 PC 1 212 11-24-2011
CotB homologs 2 family PCC8801_1381 YP_002371597.1 Cyanothece sp. PCC8801 PC+PEI 2 220 09-26-2011
CotB homologs 2 family Cyan8802_1415 YP_003137167.1 Cyanothece sp. PCC8802 PC 1 220 09-26-2011
CotB homologs 2 family Cyan7822_1692 YP_003886956.1 Cyanothece sp. PCC7822 PC+PEI 2 223 11-24-2011
CotB homologs 2 family FJSC11DRAFT_1072 ZP_08984866.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 226 11-04-2011
CotB homologs 2 family gvip128 NP_923927.1 Gloeobacter violaceus PCC7421 PC+PEI 2 233 11-24-2011
CotB homologs 2 family gvip219 NP_924521.1 Gloeobacter violaceus PCC7421 PC+PEI 2 234 11-24-2011
CotB homologs 2 family GL6909_0310 Gloeothece sp. PCC6909/1 PC+PEI 2 221 11-24-2011
CotB homologs 2 family L8106_28841 ZP_01621447.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 226 09-26-2011
CotB homologs 2 family MC7420_7088 ZP_05023236.1 Microcoleus chthonoplastes PCC7420 PC+PEC 226 09-26-2011
CotB homologs 2 family MAE_56800 YP_001660694.1 Microcystis aeruginosa NIES-843 PC 1 222 09-26-2011
CotB homologs 2 family N9414_02366 ZP_01632466.1 Nodularia spumigena CCY9414 PC 1 226 09-26-2011
CotB homologs 2 family Npun_R1155 YP_001864824.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 226 09-26-2011
CotB homologs 2 family Synpcc7942_1721 YP_400738.1 Synechococcus elongatus PCC7942 PC 1 234 11-24-2011
CotB homologs 2 family syc2370_d YP_173080.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 234 11-24-2011
CotB homologs 2 family CYB_1190 YP_477428.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 244 09-26-2011
CotB homologs 2 family CYA_0047 YP_473542.1 Synechococcus sp. JA-3-3Ab PC 1 240 09-13-2012
CotB homologs 2 family tll0835 NP_681625.1 Thermosynechococcus elongatus BP-1 PC 1 230 09-26-2011
CotB homologs 2 family Tery_4762 YP_724189.1 Trichodesmium erythraeum IMS101 PC+PEI 223 09-26-2011
CotB homologs 2 family CMS328C Cyanidioschyzon merolae 10D PC 1 on contig c19f0009, found by tblastn 332 02-21-2012
CotB homologs 2 family CMM226C Cyanidioschyzon merolae 10D PC 1 on contig c13f0002, found by tblastn 420 02-21-2012
CotB homologs 2 family IPF_3444 CAO90548.1 Microcystis aeruginosa PCC7806 PC 1 222 10-28-2011
CotB homologs 2 family NIES39_J05080 BAI91554.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 224 10-28-2011
CotB homologs 2 family MicvaDRAFT_3625 ZP_08493520.1 Microcoleus vaginatus FGP-2 PC 1 224 10-28-2011
CotB homologs 2 family LYNGBM3L_17970 ZP_08426427.1 Lyngbya majuscula 3L PC+PEI 2 223 10-28-2011
CotB homologs 2 family OSCI_2700008 ZP_07110882.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 225 10-19-2011
CotB homologs 2 family OSCI_2700008 ZP_07110882.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 225 10-28-2011
CotB homologs 2 family CRC_02169 ZP_06308244.1 Cylindrospermopsis raciborskii CS-505 PC 1 223 10-28-2011
CotB homologs 2 family CRD_00077 ZP_06303582.1 Raphidiopsis brookii D9 PC 1 232 10-28-2011
CotB homologs 2 family Cy51472DRAFT_2076 ZP_08973280.1 Cyanothece sp. ATCC51472 PC 1 223 01-10-2012
CotB homologs 2 family ACCM5_010100026572 ZP_09250884.1 Acaryochloris sp. CCMEE5410 APC only 221 01-24-2012
CotB homologs 2 family AplaP_010100006817 ZP_06381377.1 Arthrospira (Spirulina) platensis Paraca PC 1 Incomplete - lacks C-term (end of contig) 154 09-13-2012
CotB homologs 2 family CWATWH0003_2253 EHJ13064.1 Crocosphaera watsonii WH0003 PC+PEI 213 02-22-2012
CotB homologs 2 family MICAK_3340002 CCI37520.1 Microcystis aeruginosa PCC9701 PC 1 222 08-23-2012
CotB homologs 2 family MICAG_930009 CCI29658.1 Microcystis aeruginosa PCC9808 PC 1 222 08-22-2012
CotB homologs 2 family MICAD_2540004 CCI07477.1 Microcystis aeruginosa PCC7941 PC 1 222 08-23-2012
CotB homologs 2 family MICAC_1120010 CCI00724.1 Microcystis aeruginosa PCC9443 PC 1 222 08-23-2012
CotB homologs 2 family MICAB_5520009 CCH98899.1 Microcystis aeruginosa PCC9717 PC 1 222 08-23-2012
CotB homologs 2 family MICCA_1100006 ZP_18815796.1 Microcystis aeruginosa PCC9432 PC 1 222 04-22-2013
CotB homologs 2 family MICAI_560046 ZP_10229858.1 Microcystis sp. T1-4 PC+PEI 2 222 08-22-2012
CotB homologs 2 family Osc7112_1203 YP_007114165.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 224 04-24-2013
CotB homologs 2 family Scytonema_PCC7110_joined_11888 Scytonema hofmanni PCC7110 PC+PEC 226 06-12-2013
CotB homologs 2 family FisPCC73103_3407 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 226 06-12-2013
CotB homologs 2 family FisPCC7414_4392 Fischerella muscicola PCC7414 PC+PEC 226 06-12-2013
CotB homologs 2 family Fischerella_sp._PCC7521_3617 Fischerella thermalis PCC7521 PC+PEC 226 06-12-2013
CotB homologs 2 family Chloroglopsis_PCC9212_joined_7597 Chlorogloeopsis sp. PCC9212 PC+PEC 238 06-12-2013
CotB homologs 2 family UYC_05285 Chlorogloeopsis fritschii PCC6912 PC+PEC 238 06-12-2013
CotB homologs 2 family Cal6303_1973 YP_007136978.1 Calothrix sp. PCC6303 PC+PEI 2 226 04-29-2013
CotB homologs 2 family Cal7507_3606 YP_007066832.1 Calothrix sp. PCC7507 PC+PEC 228 04-29-2013
CotB homologs 2 family Osc10802DRAFT_5467 Oscillatoria sp. PCC10802 PC+PEI 224 06-12-2013
CotB homologs 2 family Oscil6304_5510 YP_007088914.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 225 04-29-2013
CotB homologs 2 family FIS9605DRAFT_06980 Fischerella sp. PCC9605 PC+PEC 224 06-12-2013
CotB homologs 2 family Fis9431DRAFT_3726 Fischerella sp. PCC9431 PC+PEC 226 06-12-2013
CotB homologs 2 family PCC9339DRAFT_01728 Fischerella sp. PCC9339 PC+PEC 226 06-12-2013
CotB homologs 2 family Nos7524_3942 YP_007077312.1 Nostoc sp. PCC7524 PC+PEC 226 04-24-2013
CotB homologs 2 family Nos7107_3742 YP_007051453.1 Nostoc sp. PCC7107 PC+PEC 226 04-29-2013
CotB homologs 2 family Cylst_0831 YP_007145837.1 Cylindrospermum stagnale PCC7417 PC+PEC 224 04-24-2013
CotB homologs 2 family Anacy_0108 YP_007154627.1 Anabaena cylindrica PCC7122 PC+PEC 226 04-24-2013
CotB homologs 2 family Ana7108_2981 Anabaena sp. PCC7108 PC+PEC 226 06-12-2013
CotB homologs 2 family Riv7116_2427 YP_007055489.1 Rivularia sp. PCC7116 PC+PEC 227 04-24-2013
CotB homologs 2 family Syn7509DRAFT_00016380 ZP_21042037.1 Synechocystis sp. PCC7509 PC 286 04-24-2013
CotB homologs 2 family Glo7428_4423 YP_007130026.1 Gloeocapsa sp. PCC7428 PC 224 04-24-2013
CotB homologs 2 family Chro_1677 YP_007091065.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 222 04-24-2013
CotB homologs 2 family Ple7327_2704 YP_007081541.1 Pleurocapsa sp. PCC7327 PC+PEI 226 04-24-2013
CotB homologs 2 family GLO73106DRAFT_00011310 ZP_21051666.1 Gloeocapsa sp. PCC73106 PC+PEI 218 04-24-2013
CotB homologs 2 family Lepto7376_3616 YP_007072630.1 Leptolyngbya sp. PCC7376 PC+PEI 223 04-24-2013
CotB homologs 2 family Cyast_2481 YP_007166073.1 Cyanobacterium stanieri PCC7202 PC 223 04-24-2013
CotB homologs 2 family Cyan10605_2501 YP_007162626.1 Cyanobacterium aponimum PCC10605 222 04-29-2013
CotB homologs 2 family Sta7437_1180 YP_007131717.1 Stanieria cyanosphaera PCC7437 PC+PEI 220 04-29-2013
CotB homologs 2 family Xen7305DRAFT_00015010 ZP_21056717.1 Xenococcus sp. PCC7305 PC+PEI 224 04-24-2013
CotB homologs 2 family Mic7113_0797 YP_007120111.1 Microcoleus sp. PCC7113 PC+PEI 2 223 04-24-2013
CotB homologs 2 family Cri9333_3249 YP_007143591.1 Crinalium epipsammum PCC9333 PC 224 04-29-2013
CotB homologs 2 family Cha6605_3987 YP_007098476.1 Chamaesiphon minutus PCC6605 PC+PEI 229 04-29-2013
CotB homologs 2 family Lep6406DRAFT_00051850 ZP_21043592.1 Leptolyngbya sp. PCC6406 PC+PEC 223 04-29-2013
CotB homologs 2 family ZP_18907631 ZP_18907631.1 Leptolyngbya sp. PCC7375 PC+PEI 2 228 04-24-2013
CotB homologs 2 family GEI7407_1098 YP_007108647.1 Geitlerinema sp. PCC7407 PC 226 04-29-2013
CotB homologs 2 family LepboDRAFT_3278 Leptolyngbya boryana PCC6306 PC 234 06-11-2013
CotB homologs 2 family Syn6312_1448 YP_007061159.1 Synechococcus sp. PCC6312 PC 234 04-29-2013
CotB homologs 2 family Syn7502_02529 YP_007106636.1 Synechococcus sp. PCC7502 PC 229 04-29-2013
CotB homologs 2 family Pse7429DRAFT_2304 ZP_21066416.1 Pseudanabaena sp. (biceps) PCC7429 PC 226 04-29-2013
CotB homologs 2 family Pse7367_3483 YP_007104147.1 Pseudanabaena sp. PCC7367 PC+PEI 223 04-24-2013
CotB homologs 2 family ZP_20932003 ZP_20932003.1 Microcystis aeruginosa TAIHU98 PC 1 222 04-24-2013
NblB family S7335_5595 ZP_05039147.1 Synechococcus sp. PCC7335 PC+PEI CA3 Blastp 223 09-26-2011
NblB family SYNPCC7002_A0348 YP_001733614.1 Synechococcus sp. PCC7002 PC 1 Blastp 218 09-26-2011
NblB family sll1663 NP_440142.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 Blastp 220 09-26-2011
NblB family alr3814 NP_487854.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC Blastp 220 09-26-2011
NblB family Ava_1888 YP_322405.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC Blastp 220 09-27-2011
NblB family Aazo_0577 YP_003720196.1 Anabaena (Nostoc) azollae 0708 PC+PEC Blastp 218 09-26-2011
NblB family AmaxDRAFT_4484 ZP_03275659.1 Arthrospira (Spirulina) maxima CS-328 PC 1 Blastp 220 09-26-2011
NblB family CwatDRAFT_3505 ZP_00516591.1 Crocosphaera watsonii WH8501 PC+PEI Blastp 219 09-26-2011
NblB family cce_3386 YP_001804800.1 Cyanothece sp. ATCC51142 PC 1 N-term shortened (15 aa removed: MRWFLVNILIYPFII) 219 09-13-2012
NblB family PCC7424_2563 YP_002377847.1 Cyanothece sp. PCC7424 PC+PEI 2 Blastp 220 09-26-2011
NblB family Cyan7425_1432 YP_002482166.1 Cyanothece sp. PCC7425 PC 1 Blastp 220 09-26-2011
NblB family PCC8801_0932 YP_002371165.1 Cyanothece sp. PCC8801 PC+PEI 2 Blastp 220 09-26-2011
NblB family Cyan8802_0959 YP_003136728.1 Cyanothece sp. PCC8802 PC 1 Blastp 220 09-26-2011
NblB family CY0110_12007 ZP_01731445.1 Cyanothece sp. CCY0110 PC 1 Blastp 219 09-26-2011
NblB family Cyan7822_3518 YP_003888735.1 Cyanothece sp. PCC7822 PC+PEI 2 Blastp 220 09-26-2011
NblB family FJSC11DRAFT_0382 ZP_08984176.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 221 11-24-2011
NblB family gvip306 NP_925180.1 Gloeobacter violaceus PCC7421 PC+PEI 2 Blastp 215 11-24-2011
NblB family GL6909_3251 Gloeothece sp. PCC6909/1 PC+PEI 2 Truncated because the original orf was fused with another 220 11-30-2011
NblB family L8106_00260 ZP_01624763.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 223 09-26-2011
NblB family MC7420_7663 ZP_05023685.1 Microcoleus chthonoplastes PCC7420 PC+PEC N-term shortened (11 aa removed: MSDYLLLNTLQ) 218 09-13-2012
NblB family MAE_14280 YP_001656442.1 Microcystis aeruginosa NIES-843 PC 1 Blastp 221 09-26-2011
NblB family N9414_09806 ZP_01630150.1 Nodularia spumigena CCY9414 PC 1 Blastp 220 09-26-2011
NblB family Npun_R5793 YP_001869034.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 Blastp 221 09-26-2011
NblB family Synpcc7942_1823 YP_400840.1 Synechococcus elongatus PCC7942 PC 1 219 08-28-2012
NblB family syc2271_d YP_172981.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 Blastp 221 09-26-2011
NblB family CYB_0185 YP_476448.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 Blastp 227 09-26-2011
NblB family CYA_2789 YP_476154.1 Synechococcus sp. JA-3-3Ab PC 1 Blastp 226 09-26-2011
NblB family tlr0766 NP_681555.1 Thermosynechococcus elongatus BP-1 PC 1 Blastp 226 09-26-2011
NblB family Tery_2239 YP_721941.1 Trichodesmium erythraeum IMS101 PC+PEI Blastp 220 09-26-2011
NblB family IPF_2775 CAO89282.1 Microcystis aeruginosa PCC7806 PC 1 221 10-28-2011
NblB family NIES39_D03910 BAI89809.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 220 10-28-2011
NblB family MicvaDRAFT_5366 ZP_08492865.1 Microcoleus vaginatus FGP-2 PC 1 224 10-28-2011
NblB family LYNGBM3L_66920 ZP_08431562.1 Lyngbya majuscula 3L PC+PEI 2 220 10-28-2011
NblB family OSCI_3860033 ZP_07113489.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 220 10-28-2011
NblB family CRC_01060 ZP_06307576.1 Cylindrospermopsis raciborskii CS-505 PC 1 226 10-28-2011
NblB family CRD_02854 ZP_06306309.1 Raphidiopsis brookii D9 PC 1 226 10-28-2011
NblB family Cy51472DRAFT_2453 ZP_08973657.1 Cyanothece sp. ATCC51472 PC 1 219 01-10-2012
NblB family AplaP_010100017289 ZP_06383430.1 Arthrospira (Spirulina) platensis Paraca PC 1 N-term shortened (18 aa removed: MRVAPDLNRQQLLNCLTK) 220 09-13-2012
NblB family CWATWH0003_3083 EHJ12197.1 Crocosphaera watsonii WH0003 PC+PEI 219 02-22-2012
NblB family MICAK_580022 CCI38703.1 Microcystis aeruginosa PCC9701 PC 1 221 08-23-2012
NblB family MICAG_200023 CCI23270.1 Microcystis aeruginosa PCC9808 PC 1 221 08-22-2012
NblB family MICAD_2940015 CCI08016.1 Microcystis aeruginosa PCC7941 PC 1 221 08-23-2012
NblB family MICAC_3690016 CCI02719.1 Microcystis aeruginosa PCC9443 PC 1 221 08-23-2012
NblB family MICAB_4960020 CCH98552.1 Microcystis aeruginosa PCC9717 PC 1 221 08-23-2012
NblB family MICCA_930006 ZP_18815469.1 Microcystis aeruginosa PCC9432 PC 1 221 04-29-2013
NblB family MICAI_3110003 ZP_10229074.1 Microcystis sp. T1-4 PC+PEI 2 221 08-22-2012
NblB family Osc7112_0710 YP_007113716.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 224 04-24-2013
NblB family Scytonema_PCC7110_joined_5306 Scytonema hofmanni PCC7110 PC+PEC 226 06-12-2013
NblB family FisPCC73103_7578 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 221 06-12-2013
NblB family FisPCC7414_2854 Fischerella muscicola PCC7414 PC+PEC 221 06-12-2013
NblB family Fischerella_sp._PCC7521_5286 Fischerella thermalis PCC7521 PC+PEC 221 06-12-2013
NblB family Chloroglopsis_PCC9212_joined_453 Chlorogloeopsis sp. PCC9212 PC+PEC 221 06-12-2013
NblB family UYC_04806 Chlorogloeopsis fritschii PCC6912 PC+PEC 221 06-12-2013
NblB family Cal6303_0988 YP_007136025.1 Calothrix sp. PCC6303 PC+PEI 2 218 04-29-2013
NblB family Cal7507_1540 YP_007064834.1 Calothrix sp. PCC7507 PC+PEC 220 04-29-2013
NblB family Osc10802DRAFT_5396 Oscillatoria sp. PCC10802 PC+PEI 336 06-12-2013
NblB family Oscil6304_1780 YP_007085378.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 222 04-29-2013
NblB family FIS9605DRAFT_03310 Fischerella sp. PCC9605 PC+PEC 220 06-12-2013
NblB family Fis9431DRAFT_1583 Fischerella sp. PCC9431 PC+PEC 221 06-12-2013
NblB family PCC9339DRAFT_01092 Fischerella sp. PCC9339 PC+PEC 221 06-12-2013
NblB family Nos7524_4874 YP_007078199.1 Nostoc sp. PCC7524 PC+PEC 220 04-24-2013
NblB family Nos7107_4026 YP_007051729.1 Nostoc sp. PCC7107 PC+PEC 221 04-29-2013
NblB family Cylst_5091 YP_007149816.1 Cylindrospermum stagnale PCC7417 PC+PEC 220 04-24-2013
NblB family Anacy_2696 YP_007157043.1 Anabaena cylindrica PCC7122 PC+PEC 220 04-24-2013
NblB family Ana7108_1853 Anabaena sp. PCC7108 PC+PEC 218 06-12-2013
NblB family Riv7116_0216 YP_007053370.1 Rivularia sp. PCC7116 PC+PEC 218 04-24-2013
NblB family Syn7509DRAFT_00041170 ZP_21039471.1 Synechocystis sp. PCC7509 PC 220 04-24-2013
NblB family Glo7428_4688 YP_007130281.1 Gloeocapsa sp. PCC7428 PC 223 04-24-2013
NblB family Chro_0989 YP_007090391.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 219 04-24-2013
NblB family Dacsa_1202 YP_007171258.1 Dactylococcopsis salina PCC8305 224 04-24-2013
NblB family PCC7418_1214 YP_007167630.1 Halothece sp. PCC7418 PC 224 04-24-2013
NblB family Ple7327_1847 YP_007080751.1 Pleurocapsa sp. PCC7327 PC+PEI 219 04-24-2013
NblB family GLO73106DRAFT_00006030 ZP_21052179.1 Gloeocapsa sp. PCC73106 PC+PEI 218 04-24-2013
NblB family Lepto7376_0558 YP_007069818.1 Leptolyngbya sp. PCC7376 PC+PEI 218 04-24-2013
NblB family Cyast_1913 YP_007165517.1 Cyanobacterium stanieri PCC7202 PC 221 04-24-2013
NblB family Cyan10605_2137 YP_007162269.1 Cyanobacterium aponimum PCC10605 219 04-29-2013
NblB family Sta7437_3389 YP_007133861.1 Stanieria cyanosphaera PCC7437 PC+PEI 220 04-29-2013
NblB family Xen7305DRAFT_00012810 ZP_21056844.1 Xenococcus sp. PCC7305 PC+PEI 219 04-24-2013
NblB family Mic7113_4080 YP_007123190.1 Microcoleus sp. PCC7113 PC+PEI 2 218 04-24-2013
NblB family Cri9333_0875 YP_007141302.1 Crinalium epipsammum PCC9333 PC 221 04-29-2013
NblB family Cha6605_0245 YP_007095074.1 Chamaesiphon minutus PCC6605 PC+PEI 213 04-29-2013
NblB family Lep6406DRAFT_00023300 ZP_21046418.1 Leptolyngbya sp. PCC6406 PC+PEC 220 04-29-2013
NblB family ZP_18908692 ZP_18908692.1 Leptolyngbya sp. PCC7375 PC+PEI 2 223 04-24-2013
NblB family GEI7407_0128 YP_007107685.1 Geitlerinema sp. PCC7407 PC 220 04-29-2013
NblB family LepboDRAFT_1028 Leptolyngbya boryana PCC6306 PC 219 06-11-2013
NblB family Syn6312_0129 YP_007059926.1 Synechococcus sp. PCC6312 PC 222 04-29-2013
NblB family Syn7502_00033 YP_007104343.1 Synechococcus sp. PCC7502 PC 219 06-20-2013
NblB family Pse7429DRAFT_0756 ZP_21065042.1 Pseudanabaena sp. (biceps) PCC7429 PC 225 06-20-2013
NblB family Pse7367_2182 YP_007102874.1 Pseudanabaena sp. PCC7367 PC+PEI 241 06-20-2013
NblB family ZP_20934124 ZP_20934124.1 Microcystis aeruginosa TAIHU98 PC 1 221 04-24-2013
CpcS family AM1_4215 YP_001518512.1 Acaryochloris marina MBIC11017 (AM1) PC 1 1st copy, strange position in phylogeny. By blast: closer from CpcSI. 197 08-20-2012
CpcS family AM1_C0217 YP_001521653.1 Acaryochloris marina MBIC11017 (AM1) PC 1 2nd copy,strange position in phylogeny. By blast: closer from CpcSI. Located on preb3 plasmid. 208 08-20-2012
CpcS family CMR092C Cyanidioschyzon merolae 10D PC 1 long N-term compared to cyanobacterial CpcS sequences, found by tblastn 405 02-21-2012
CpcS-I subfamily S7335_4321 ZP_05037881.1 Synechococcus sp. PCC7335 PC+PEI CA3 This sequence is closely related to CpcS-I, but the genome of PCC7335 apparently does not contain any CpcU-I, possibly because it is incomplete. 200 10-03-2012
CpcS-I subfamily SYNPCC7002_A1822 YP_001735066.1 Synechococcus sp. PCC7002 PC 1 198 09-26-2011
CpcS-I subfamily slr2049 NP_440437.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 192 09-26-2011
CpcS-I subfamily AmaxDRAFT_2794 ZP_03273970.1 Arthrospira (Spirulina) maxima CS-328 PC 1 197 09-26-2011
CpcS-I subfamily CwatDRAFT_6342 ZP_00514111.1 Crocosphaera watsonii WH8501 PC+PEI 197 09-26-2011
CpcS-I subfamily cce_3207 YP_001804621.1 Cyanothece sp. ATCC51142 PC 1 198 09-26-2011
CpcS-I subfamily PCC7424_3509 YP_002378769.1 Cyanothece sp. PCC7424 PC+PEI 2 197 09-26-2011
CpcS-I subfamily PCC8801_1352 YP_002371570.1 Cyanothece sp. PCC8801 PC+PEI 2 200 09-26-2011
CpcS-I subfamily Cyan8802_1382 YP_003137135.1 Cyanothece sp. PCC8802 PC 1 200 09-26-2011
CpcS-I subfamily CY0110_04081 ZP_01730273.1 Cyanothece sp. CCY0110 PC 1 197 09-26-2011
CpcS-I subfamily Cyan7822_2533 YP_003887780.1 Cyanothece sp. PCC7822 PC+PEI 2 198 09-26-2011
CpcS-I subfamily gvip161 NP_924137.1 Gloeobacter violaceus PCC7421 PC+PEI 2 strange position in phylogenetic trees 201 01-18-2018
CpcS-I subfamily GL6909_5285 Gloeothece sp. PCC6909/1 PC+PEI 2 198 05-31-2011
CpcS-I subfamily L8106_24665 ZP_01619909.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 No other start codon before this sequence 197 09-26-2011
CpcS-I subfamily MAE_48330 YP_001659847.1 Microcystis aeruginosa NIES-843 PC 1 A stop codon, then 4aa, then the start codon 193 09-26-2011
CpcS-I subfamily Npun_F3809 YP_001867136.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 CpcSIII in Schluchter et al., 2010? 206 09-26-2011
CpcS-I subfamily Synpcc7942_2031 YP_401048.1 Synechococcus elongatus PCC7942 PC 1 193 09-26-2011
CpcS-I subfamily syc2064_d YP_172774.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 193 11-25-2011
CpcS-I subfamily Tery_3908 YP_723414.1 Trichodesmium erythraeum IMS101 PC+PEI N-term shortened (5 aa removed: MEYRL) 196 08-30-2012
CpcS-I subfamily IPF_855 CAO87966.1 Microcystis aeruginosa PCC7806 PC 1 193 10-20-2011
CpcS-I subfamily NIES39_A02700 BAI88109.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 197 10-20-2011
CpcS-I subfamily MicvaDRAFT_5174 ZP_08495221.1 Microcoleus vaginatus FGP-2 PC 1 198 10-20-2011
CpcS-I subfamily LYNGBM3L_55940 ZP_08427741.1 Lyngbya majuscula 3L PC+PEI 2 216 10-19-2011
CpcS-I subfamily OSCI_700007 ZP_07109069.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 197 10-19-2011
CpcS-I subfamily Cy51472DRAFT_4686 ZP_08975889.1 Cyanothece sp. ATCC51472 PC 1 198 01-10-2012
CpcS-I subfamily ACCM5_010100032969 ZP_09252138.1 Acaryochloris sp. CCMEE5410 APC only 196 08-24-2012
CpcS-I subfamily AplaP_010100006702 ZP_06381354.1 Arthrospira (Spirulina) platensis Paraca PC 1 197 01-24-2012
CpcS-I subfamily CWATWH0003_0565 EHJ14767.1 Crocosphaera watsonii WH0003 PC+PEI 197 02-22-2012
CpcS-I subfamily MICAK_3480004 CCI37760.1 Microcystis aeruginosa PCC9701 PC 1 193 08-23-2012
CpcS-I subfamily MICAG_860004 CCI29527.1 Microcystis aeruginosa PCC9808 PC 1 193 08-22-2012
CpcS-I subfamily MICAD_310004 CCI08315.1 Microcystis aeruginosa PCC7941 PC 1 193 08-23-2012
CpcS-I subfamily MICAC_4950001 CCI03754.1 Microcystis aeruginosa PCC9443 PC 1 193 08-23-2012
CpcS-I subfamily MICAB_3830008 CCH97799.1 Microcystis aeruginosa PCC9717 PC 1 193 08-23-2012
CpcS-I subfamily MICCA_980010 ZP_18815604.1 Microcystis aeruginosa PCC9432 PC 1 193 04-22-2013
CpcS-I subfamily MICAI_250011 ZP_10228158.1 Microcystis sp. T1-4 PC+PEI 2 193 09-16-2012
CpcS-I subfamily Osc7112_3154 YP_007115956.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 198 04-22-2013
CpcS-I subfamily Cal6303_1002 YP_007136039.1 Calothrix sp. PCC6303 PC+PEI 2 196 06-20-2013
CpcS-I subfamily Osc10802DRAFT_6754 Oscillatoria sp. PCC10802 PC+PEI 204 06-12-2013
CpcS-I subfamily Oscil6304_1130 YP_007084776.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 203 04-29-2013
CpcS-I subfamily Dacsa_0540 YP_007170680.1 Dactylococcopsis salina PCC8305 194 04-23-2013
CpcS-I subfamily PCC7418_3218 YP_007169548.1 Halothece sp. PCC7418 PC 193 04-23-2013
CpcS-I subfamily Ple7327_2633 YP_007081472.1 Pleurocapsa sp. PCC7327 PC+PEI 198 04-23-2013
CpcS-I subfamily GLO73106DRAFT_00025640 ZP_21050308.1 Gloeocapsa sp. PCC73106 PC+PEI 197 04-23-2013
CpcS-I subfamily Lepto7376_3399 YP_007072440.1 Leptolyngbya sp. PCC7376 PC+PEI 200 04-23-2013
CpcS-I subfamily Cyast_1790 YP_007165395.1 Cyanobacterium stanieri PCC7202 PC 196 04-23-2013
CpcS-I subfamily Cyan10605_0823 YP_007160999.1 Cyanobacterium aponimum PCC10605 194 04-29-2013
CpcS-I subfamily Sta7437_2864 YP_007133350.1 Stanieria cyanosphaera PCC7437 PC+PEI 199 04-22-2013
CpcS-I subfamily Xen7305DRAFT_00011740 ZP_21056994.1 Xenococcus sp. PCC7305 PC+PEI 199 04-23-2013
CpcS-I subfamily Mic7113_2585 YP_007121784.1 Microcoleus sp. PCC7113 PC+PEI 2 205 04-23-2013
CpcS-I subfamily Cha6605_1319 YP_007096040.1 Chamaesiphon minutus PCC6605 PC+PEI 200 04-29-2013
CpcS-I subfamily Lep6406DRAFT_00042270 ZP_21044550.1 Leptolyngbya sp. PCC6406 PC+PEC 198 06-20-2013
CpcS-I subfamily ZP_18908102 ZP_18908102.1 Leptolyngbya sp. PCC7375 PC+PEI 2 204 04-23-2013
CpcS-I subfamily LepboDRAFT_3190 Leptolyngbya boryana PCC6306 PC 195 06-11-2013
CpcS-I subfamily Pse7429DRAFT_3448 ZP_21067785.1 Pseudanabaena sp. (biceps) PCC7429 PC 200 04-24-2013
CpcS-I subfamily Pse7367_3816 YP_007083475.1 Pseudanabaena sp. PCC7367 PC+PEI 208 04-23-2013
CpcS-I subfamily O53_3911 ZP_20934710.1 Microcystis aeruginosa TAIHU98 PC 1 193 04-22-2013
CpcS-II subfamily sync_2487 YP_731681.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 203 09-26-2011
CpcS-II subfamily Syncc9605_2286 YP_382575.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 197 09-26-2011
CpcS-II subfamily SH8109_0894 ZP_05790285.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 197 09-26-2011
CpcS-II subfamily SYNW0315 NP_896410.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 198 09-26-2011
CpcS-II subfamily Syncc9902_0400 YP_376414.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 198 09-26-2011
CpcS-II subfamily BL107_17200 ZP_01468673.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 198 09-26-2011
CpcS-II subfamily SynWH7803_2155 YP_001225878.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 196 09-26-2011
CpcS-II subfamily WH7805_11643 ZP_01122710.1 Synechococcus sp. WH7805 PC+PEI 2 196 09-26-2011
CpcS-II subfamily RS9917_07715 ZP_01081133.1 Synechococcus sp. RS9917 PC 1 206 09-26-2011
CpcS-II subfamily RS9916_35312 ZP_01471093.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 202 09-26-2011
CpcS-II subfamily WH5701_15871 ZP_01084219.1 Synechococcus sp. WH5701 PC 1 Frameshifted; join(2811210..2811479,2811479..2811838) 209 09-26-2011
CpcS-II subfamily SynRCC307_2024 YP_001228280.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 196 09-26-2011
CpcS-II subfamily SCB01_010100002463 ZP_07972490.1 Synechococcus sp. CB0101 PC 1 MAACDHRCTRRAA removed at the beginning 203 11-04-2011
CpcS-II subfamily SCB02_010100000529 ZP_07969387.1 Synechococcus sp. CB0205 PC+PEI 2 201 11-04-2011
CpcS-II subfamily CPCC7001_2732 ZP_05046541.1 Cyanobium sp. PCC7001 PC 1 200 09-26-2011
CpcS-II subfamily Syn8016DRAFT_2357 ZP_08957012.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 203 11-04-2011
CpcS-II subfamily PCC_0659 YP_002049288.1 Paulinella chromatophora M0880 PC 1 Protoscan score is not very high, but it matches CpcS-II best 198 08-30-2012
CpcS-II subfamily SynWH8020_CpcSII Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A From unpublished WH8020 genome 203 08-27-2012
CpcS-II subfamily Cyagr_1540 YP_007046040.1 Cyanobium gracile PCC6307 PC 206 04-29-2013
CpcS-III subfamily alr0617 NP_484661.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 188 09-26-2011
CpcS-III subfamily Ava_4549 YP_325042.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 188 09-27-2011
CpcS-III subfamily Aazo_1709 YP_003720981.1 Anabaena (Nostoc) azollae 0708 PC+PEC 191 09-26-2011
CpcS-III subfamily Cyan7425_2083 YP_002482807.1 Cyanothece sp. PCC7425 PC 1 188 09-26-2011
CpcS-III subfamily FJSC11DRAFT_1071 ZP_08984865.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 187 11-04-2011
CpcS-III subfamily MC7420_7485 ZP_05023633.1 Microcoleus chthonoplastes PCC7420 PC+PEC 186 09-26-2011
CpcS-III subfamily N9414_02356 ZP_01632464.1 Nodularia spumigena CCY9414 PC 1 188 09-26-2011
CpcS-III subfamily CYB_2841 YP_479027.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 190 09-26-2011
CpcS-III subfamily CYA_2807 YP_476172.1 Synechococcus sp. JA-3-3Ab PC 1 187 09-26-2011
CpcS-III subfamily tll1699 NP_682489.1 Thermosynechococcus elongatus BP-1 PC 1 3D structure available (pdb:3BDR). N-term shortened (4 aa removed) 178 08-29-2012
CpcS-III subfamily CRC_02172 ZP_06308247.1 Cylindrospermopsis raciborskii CS-505 PC 1 Fusion of CRC_02170 and CRC_02172. Contains a group II intron (same as D9 strain). KHEGSTVLVTVPDLLKPGEGKLLRE added before CRC_02172 197 12-02-2011
CpcS-III subfamily CRD_00076 ZP_06303581.1 Raphidiopsis brookii D9 PC 1 Contains a group II intron containing an orf (gi|282895443|ref|ZP_06303580.1|)
This sequence is the fusion of CRD_00076 and CRD_00074 (KHEGSTVLVTVPDLLKPGEGKLLRE added before CRD_00074)
197 11-02-2011
CpcS-III subfamily Scytonema_PCC7110_joined_11887 Scytonema hofmanni PCC7110 PC+PEC 189 06-12-2013
CpcS-III subfamily FisPCC73103_3408 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 187 06-12-2013
CpcS-III subfamily FisPCC7414_4393 Fischerella muscicola PCC7414 PC+PEC 187 06-12-2013
CpcS-III subfamily Fischerella_sp._PCC7521_3615 Fischerella thermalis PCC7521 PC+PEC 187 06-12-2013
CpcS-III subfamily Chloroglopsis_PCC9212_joined_7598 Chlorogloeopsis sp. PCC9212 PC+PEC 189 06-12-2013
CpcS-III subfamily UYC_05286 Chlorogloeopsis fritschii PCC6912 PC+PEC 189 06-12-2013
CpcS-III subfamily Cal7507_3605 YP_007066831.1 Calothrix sp. PCC7507 PC+PEC 188 04-29-2013
CpcS-III subfamily FIS9605DRAFT_06979 Fischerella sp. PCC9605 PC+PEC 188 06-12-2013
CpcS-III subfamily Fis9431DRAFT_3727 Fischerella sp. PCC9431 PC+PEC 187 06-12-2013
CpcS-III subfamily PCC9339DRAFT_01730 Fischerella sp. PCC9339 PC+PEC 187 06-12-2013
CpcS-III subfamily Nos7524_3943 YP_007077313.1 Nostoc sp. PCC7524 PC+PEC 187 04-23-2013
CpcS-III subfamily Nos7107_3741 YP_007051452.1 Nostoc sp. PCC7107 PC+PEC 187 04-29-2013
CpcS-III subfamily Cylst_0830 YP_007145836.1 Cylindrospermum stagnale PCC7417 PC+PEC 191 04-23-2013
CpcS-III subfamily Anacy_0109 YP_007154628.1 Anabaena cylindrica PCC7122 PC+PEC 190 04-23-2013
CpcS-III subfamily Ana7108_2980 Anabaena sp. PCC7108 PC+PEC 191 06-12-2013
CpcS-III subfamily Riv7116_2426 YP_007055488.1 Rivularia sp. PCC7116 PC+PEC 188 04-23-2013
CpcS-III subfamily Syn7509DRAFT_00025220 ZP_21040972.1 Synechocystis sp. PCC7509 PC 185 04-22-2013
CpcS-III subfamily Glo7428_4424 YP_007130027.1 Gloeocapsa sp. PCC7428 PC 187 04-22-2013
CpcS-III subfamily Chro_1676 YP_007091064.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 186 04-23-2013
CpcS-III subfamily Mic7113_0798 YP_007120112.1 Microcoleus sp. PCC7113 PC+PEI 2 Found both CpcS-I and CpcS-III in this strain? 188 06-20-2013
CpcS-III subfamily Cri9333_3248 YP_007143590.1 Crinalium epipsammum PCC9333 PC 186 06-20-2013
CpcS-III subfamily GEI7407_2263 YP_007109790.1 Geitlerinema sp. PCC7407 PC 186 06-20-2013
CpcS-III subfamily Syn6312_0613 YP_007060377.1 Synechococcus sp. PCC6312 PC 186 06-12-2013
CpcS-III subfamily Syn7502_02665 YP_007106758.1 Synechococcus sp. PCC7502 PC 172 06-20-2013
CpcU-I subfamily SYNPCC7002_A2053 YP_001735295.1 Synechococcus sp. PCC7002 PC 1 183 09-26-2011
CpcU-I subfamily Sll0853 NP_441116.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 N-term shortened (11 aa removed: MKPVAPRSFFA) 175 09-16-2012
CpcU-I subfamily AM1_5938 YP_001520196.1 Acaryochloris marina MBIC11017 (AM1) PC 1 N-term extended (22 aa added). Low blast and protomatch score with other CpcU-I sequences. 184 09-16-2012
CpcU-I subfamily AmaxDRAFT_1245 ZP_03272427.1 Arthrospira (Spirulina) maxima CS-328 PC 1 Fairly low blast score to other CpcU-I sequences. 172 09-16-2012
CpcU-I subfamily CwatDRAFT_4215 ZP_00515818.1 Crocosphaera watsonii WH8501 PC+PEI 175 09-26-2011
CpcU-I subfamily cce_3775 YP_001805189.1 Cyanothece sp. ATCC51142 PC 1 N-term shortened (2 aa removed: MF) 175 09-16-2012
CpcU-I subfamily PCC7424_0571 YP_002375901.1 Cyanothece sp. PCC7424 PC+PEI 2 172 09-26-2011
CpcU-I subfamily PCC8801_1382 YP_002371598.1 Cyanothece sp. PCC8801 PC+PEI 2 176 09-26-2011
CpcU-I subfamily Cyan8802_1416 YP_003137168.1 Cyanothece sp. PCC8802 PC 1 176 09-26-2011
CpcU-I subfamily CY0110_18677 ZP_01727104.1 Cyanothece sp. CCY0110 PC 1 175 09-26-2011
CpcU-I subfamily Cyan7822_1691 YP_003886955.1 Cyanothece sp. PCC7822 PC+PEI 2 172 09-26-2011
CpcU-I subfamily glr1614 NP_924560.1 Gloeobacter violaceus PCC7421 PC+PEI 2 212 09-26-2011
CpcU-I subfamily GL6909_0312 Gloeothece sp. PCC6909/1 PC+PEI 2 172 05-31-2011
CpcU-I subfamily L8106_16679 ZP_01620367.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 176 09-26-2011
CpcU-I subfamily MAE_56790 YP_001660693.1 Microcystis aeruginosa NIES-843 PC 1 170 09-26-2011
CpcU-I subfamily Npun_R1154 YP_001864823.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 188 09-26-2011
CpcU-I subfamily Synpcc7942_0161 YP_399180.1 Synechococcus elongatus PCC7942 PC 1 N-term possibly 12 aa too long (MGDSKGRVASAA). Fairly low blast score to other CpcU-I sequences. 180 09-16-2012
CpcU-I subfamily syc1345_c YP_172055.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 N-term possibly 12 aa too long (MGDSKGRVASAA). Fairly low blast score to other CpcU-I sequences. 180 09-16-2012
CpcU-I subfamily Tery_3198 YP_722794.1 Trichodesmium erythraeum IMS101 PC+PEI 174 09-26-2011
CpcU-I subfamily IPF_3445 CAO90549.1 Microcystis aeruginosa PCC7806 PC 1 171 10-20-2011
CpcU-I subfamily NIES39_R01090 BAI94418.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 174 10-20-2011
CpcU-I subfamily MicvaDRAFT_5310 ZP_08492814.1 Microcoleus vaginatus FGP-2 PC 1 169 10-20-2011
CpcU-I subfamily LYNGBM3L_17960 ZP_08426426.1 Lyngbya majuscula 3L PC+PEI 2 Protomata tells it is CpcU.
Blast tells it is CpcSIII (but with a 17aa gap)
190 10-19-2011
CpcU-I subfamily OSCI_1150017 ZP_07109767.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 192 10-19-2011
CpcU-I subfamily Cy51472DRAFT_2075 ZP_08973279.1 Cyanothece sp. ATCC51472 PC 1 175 01-10-2012
CpcU-I subfamily ACCM5_010100021921 ZP_09249963.1 Acaryochloris sp. CCMEE5410 APC only 184 01-24-2012
CpcU-I subfamily AplaP_010100016770 ZP_06383329.1 Arthrospira (Spirulina) platensis Paraca PC 1 174 01-24-2012
CpcU-I subfamily CWATWH0003_2252 EHJ13063.1 Crocosphaera watsonii WH0003 PC+PEI 175 02-22-2012
CpcU-I subfamily MICAK_3340003 CCI37521.1 Microcystis aeruginosa PCC9701 PC 1 170 08-23-2012
CpcU-I subfamily MICAG_930008 CCI29657.1 Microcystis aeruginosa PCC9808 PC 1 170 08-22-2012
CpcU-I subfamily MICAD_2540005 CCI07478.1 Microcystis aeruginosa PCC7941 PC 1 170 08-23-2012
CpcU-I subfamily MICAC_1120009 CCI00723.1 Microcystis aeruginosa PCC9443 PC 1 171 08-23-2012
CpcU-I subfamily MICAB_5520008 CCH98898.1 Microcystis aeruginosa PCC9717 PC 1 170 08-23-2012
CpcU-I subfamily MICCA_1100007 ZP_18815797.1 Microcystis aeruginosa PCC9432 PC 1 170 04-29-2013
CpcU-I subfamily MICAI_560047 ZP_10229859.1 Microcystis sp. T1-4 PC+PEI 2 170 08-22-2012
CpcU-I subfamily Osc7112_0647 YP_007113656.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 169 04-22-2013
CpcU-I subfamily Cal6303_1972 YP_007136977.1 Calothrix sp. PCC6303 PC+PEI 2 176 06-20-2013
CpcU-I subfamily Osc10802DRAFT_5465 Oscillatoria sp. PCC10802 PC+PEI N-term shortened (44 aa) 185 07-02-2013
CpcU-I subfamily Oscil6304_5543 YP_007088946.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 177 04-22-2013
CpcU-I subfamily Dacsa_0519 YP_007170660.1 Dactylococcopsis salina PCC8305 190 06-20-2013
CpcU-I subfamily PCC7418_3771 YP_007170089.1 Halothece sp. PCC7418 PC 179 06-20-2013
CpcU-I subfamily GLO73106DRAFT_00011320 ZP_21051667.1 Gloeocapsa sp. PCC73106 PC+PEI 174 06-20-2013
CpcU-I subfamily Lepto7376_2440 YP_007071553.1 Leptolyngbya sp. PCC7376 PC+PEI 183 06-20-2013
CpcU-I subfamily Cyast_0213 YP_007163844.1 Cyanobacterium stanieri PCC7202 PC 173 06-20-2013
CpcU-I subfamily Cyan10605_0119 YP_007160321.1 Cyanobacterium aponimum PCC10605 182 06-20-2013
CpcU-I subfamily Sta7437_1181 YP_007131718.1 Stanieria cyanosphaera PCC7437 PC+PEI 186 06-20-2013
CpcU-I subfamily Xen7305DRAFT_00032080 ZP_21054973.1 Xenococcus sp. PCC7305 PC+PEI 177 04-29-2013
CpcU-I subfamily Cha6605_3988 YP_007098477.1 Chamaesiphon minutus PCC6605 PC+PEI 183 06-20-2013
CpcU-I subfamily Lep6406DRAFT_00043770 ZP_21044403.1 Leptolyngbya sp. PCC6406 PC+PEC 173 06-20-2013
CpcU-I subfamily Lepto7375DRAFT_4641 ZP_18909026.1 Leptolyngbya sp. PCC7375 PC+PEI 2 169 06-20-2013
CpcU-I subfamily Pse7367_2638 YP_007103322.1 Pseudanabaena sp. PCC7367 PC+PEI 178 06-20-2013
CpcU-I subfamily O53_764 ZP_20931601.1 Microcystis aeruginosa TAIHU98 PC 1 170 04-22-2013
CpcU-II subfamily sync_0774 YP_729988.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 158 11-04-2011
CpcU-II subfamily Syncc9605_0889 YP_381212.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 153 11-04-2011
CpcU-II subfamily SH8109_1400 ZP_05790078.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 153 12-02-2011
CpcU-II subfamily SYNW1611 NP_897704.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 154 11-04-2011
CpcU-II subfamily Syncc9902_1509 YP_377511.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 154 11-04-2011
CpcU-II subfamily BL107_11196 ZP_01469616.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 154 11-04-2011
CpcU-II subfamily SynWH7803_1725 YP_001225448.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 153 11-04-2011
CpcU-II subfamily WH7805_05516 ZP_01124634.1 Synechococcus sp. WH7805 PC+PEI 2 N-term shortened (7 aa removed: MSCEDGS) 153 09-16-2012
CpcU-II subfamily RS9917_01916 ZP_01081335.1 Synechococcus sp. RS9917 PC 1 156 11-04-2011
CpcU-II subfamily RS9916_33072 ZP_01470645.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A N-term possibly 12 aa too long 169 09-16-2012
CpcU-II subfamily WH5701_14506 ZP_01083946.1 Synechococcus sp. WH5701 PC 1 162 11-04-2011
CpcU-II subfamily SynRCC307_1726 YP_001227982.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 151 11-04-2011
CpcU-II subfamily SCB01_010100010455 ZP_07974079.1 Synechococcus sp. CB0101 PC 1 161 12-02-2011
CpcU-II subfamily SCB02_010100006257 ZP_07970508.1 Synechococcus sp. CB0205 PC+PEI 2 154 12-02-2011
CpcU-II subfamily CPCC7001_xx Cyanobium sp. PCC7001 PC 1 Found using tblastn. Orf not detected in refseq. 166 02-21-2012
CpcU-II subfamily Syn8016DRAFT_2448 ZP_08957102.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 158 12-02-2011
CpcU-II subfamily PCC_0138 YP_002048800.1 Paulinella chromatophora M0880 PC 1 157 09-16-2012
CpcU-II subfamily Cyagr_1229 YP_007045748.1 Cyanobium gracile PCC6307 PC 177 04-29-2013
CpeS-I subfamily S7335_2433 ZP_05036001.1 Synechococcus sp. PCC7335 PC+PEI CA3 176 09-26-2011
CpeS-I subfamily CwatDRAFT_5719 ZP_00514726.1 Crocosphaera watsonii WH8501 PC+PEI 179 09-26-2011
CpeS-I subfamily PCC7424_5723 YP_002381018.1 Cyanothece sp. PCC7424 PC+PEI 2 177 09-26-2011
CpeS-I subfamily PCC8801_4527 YP_002364804.1 Cyanothece sp. PCC8801 PC+PEI 2 179 09-26-2011
CpeS-I subfamily Cyan7822_4033 YP_003889233.1 Cyanothece sp. PCC7822 PC+PEI 2 177 09-26-2011
CpeS-I subfamily gi|145967347|gb|ABP99029.1| ABP99029.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 N-term shortened (6 aa removed: METKVL). C-term much longer than in other CpeS-I sequences and also includes a specific sequence at between aa 103-112. 215 09-17-2012
CpeS-I subfamily gvip162 NP_924138.1 Gloeobacter violaceus PCC7421 PC+PEI 2 180 11-24-2011
CpeS-I subfamily GL6909_3548 Gloeothece sp. PCC6909/1 PC+PEI 2 179 05-31-2011
CpeS-I subfamily Npun_F0737 YP_001864432.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 178 09-26-2011
CpeS-I subfamily Tery_4106 YP_723587.1 Trichodesmium erythraeum IMS101 PC+PEI 173 09-26-2011
CpeS-I subfamily LYNGBM3L_16710 ZP_08428242.1 Lyngbya majuscula 3L PC+PEI 2 178 10-19-2011
CpeS-I subfamily OSCI_1700002 ZP_07110201.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 N-term shortened (2 aa removed: MP) 177 09-16-2012
CpeS-I subfamily CWATWH0003_1105 EHJ14216.1 Crocosphaera watsonii WH0003 PC+PEI 179 02-22-2012
CpeS-I subfamily MICAI_380005 ZP_10229442.1 Microcystis sp. T1-4 PC+PEI 2 177 08-22-2012
CpeS-I subfamily Osc7112_1030 YP_007114004.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 181 04-24-2013
CpeS-I subfamily Cal6303_1334 YP_007136366.1 Calothrix sp. PCC6303 PC+PEI 2 180 04-29-2013
CpeS-I subfamily Osc10802DRAFT_5368 Oscillatoria sp. PCC10802 PC+PEI 194 06-12-2013
CpeS-I subfamily Ple7327_0106 YP_007079149.1 Pleurocapsa sp. PCC7327 PC+PEI 178 04-24-2013
CpeS-I subfamily GLO73106DRAFT_00012580 ZP_21051594.1 Gloeocapsa sp. PCC73106 PC+PEI 176 04-24-2013
CpeS-I subfamily Lepto7376_0477 YP_007069743.1 Leptolyngbya sp. PCC7376 PC+PEI 177 04-24-2013
CpeS-I subfamily Sta7437_0960 YP_007131508.1 Stanieria cyanosphaera PCC7437 PC+PEI 179 04-29-2013
CpeS-I subfamily Xen7305DRAFT_00019040 ZP_21056252.1 Xenococcus sp. PCC7305 PC+PEI 181 04-24-2013
CpeS-I subfamily Mic7113_4756 YP_007123835.1 Microcoleus sp. PCC7113 PC+PEI 2 175 04-24-2013
CpeS-I subfamily Cha6605_4067 YP_007098550.1 Chamaesiphon minutus PCC6605 PC+PEI 178 04-29-2013
CpeS-I subfamily ZP_18907660 ZP_18907660.1 Leptolyngbya sp. PCC7375 PC+PEI 2 175 04-24-2013
CpeS-I subfamily Pse7429DRAFT_1237 ZP_21065324.1 Pseudanabaena sp. (biceps) PCC7429 PC 180 06-20-2013
CpeS-I subfamily Pse7367_3898 YP_007083553.1 Pseudanabaena sp. PCC7367 PC+PEI 183 04-24-2013
CpeS-II subfamily sync_0510 YP_729737.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 179 09-26-2011
CpeS-II subfamily Syncc9605_0441 YP_380772.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 180 09-26-2011
CpeS-II subfamily SH8109_0064 ZP_05789382.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 180 09-26-2011
CpeS-II subfamily SYNW2002 NP_898093.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 180 09-26-2011
CpeS-II subfamily Syncc9902_1886 YP_377887.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 178 09-26-2011
CpeS-II subfamily BL107_08991 ZP_01469901.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A 178 09-26-2011
CpeS-II subfamily SynWH7803_0499 YP_001224222.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 178 09-26-2011
CpeS-II subfamily WH7805_06671 ZP_01123334.1 Synechococcus sp. WH7805 PC+PEI 2 178 09-26-2011
CpeS-II subfamily RS9916_40271 ZP_01473097.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A 178 09-26-2011
CpeS-II subfamily SynRCC307_2041 YP_001228297.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 177 09-26-2011
CpeS-II subfamily SCB02_010100004283 ZP_07970126.1 Synechococcus sp. CB0205 PC+PEI 2 177 11-04-2011
CpeS-II subfamily Syn8016DRAFT_2761 ZP_08957414.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA 179 11-04-2011
CpeS-II subfamily NATL1_03911 YP_001014220.1 Prochlorococcus marinus NATL1A PEIII high b/a N-term extended (16 aa added) 177 08-28-2012
CpeS-II subfamily PMN2A_1677 YP_292868.1 Prochlorococcus marinus NATL2A PEIII high b/a 177 11-25-2011
CpeS-II subfamily Pro0343 NP_874737.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 181 11-25-2011
CpeS-II subfamily P9211_03381 YP_001550223.1 Prochlorococcus marinus MIT9211 PEIII High b/a 178 11-25-2011
CpeS-II subfamily P9303_22301 YP_001018230.1 Prochlorococcus sp. MIT9303 PEIII high b/a N-term extended: MNIEQFVDQSEGTWRS added by FP 177 09-26-2011
CpeS-II subfamily PMT1677 NP_895504.1 Prochlorococcus sp. MIT9313 PEIII high b/a 177 09-26-2011
CpeS-II subfamily SynWH8020_CpeSII Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A From unpublished WH8020 genome 179 08-27-2012
CpeS-ProHL subfamily PMM0306 NP_892425.1 Prochlorococcus marinus MED4 (CCMP1986/CCMP1378) beta-PEIII low b/a 183 09-26-2011
CpeS-ProHL subfamily P9515_03401 YP_001010656.1 Prochlorococcus marinus MIT9515 beta-PEIII low b/a 183 09-26-2011
CpeS-ProHL subfamily P9301_03311 YP_001090555.1 Prochlorococcus marinus MIT9301 beta-PEIII low b/a 182 09-26-2011
CpeS-ProHL subfamily A9601_03301 YP_001008725.1 Prochlorococcus marinus AS9601 beta-PEIII low b/a 183 09-26-2011
CpeS-ProHL subfamily P9215_03311 YP_001483534.1 Prochlorococcus marinus MIT9215 beta-PEIII low b/a 183 09-26-2011
CpeS-ProHL subfamily PMT9312_0308 YP_396805.1 Prochlorococcus marinus MIT9312 beta-PEIII low b/a 183 09-26-2011
CpeS-ProHL subfamily P9202_xx Prochlorococcus marinus MIT9202 beta-PEIII low b/a Not in Refseq, found with tblastn in JCVI sequence 183 02-21-2012
CpeS-ProHL subfamily PUH18301_0334 Prochlorococcus marinus UH18301 beta-PEIII low b/a 183 05-31-2011
CpeU-I subfamily S7335_5494 ZP_05039049.1 Synechococcus sp. PCC7335 PC+PEI CA3 185 11-25-2011
CpeU-I subfamily PCC7424_5736 YP_002381031.1 Cyanothece sp. PCC7424 PC+PEI 2 197 11-25-2011
CpeU-I subfamily PCC8801_4521 YP_002364799.1 Cyanothece sp. PCC8801 PC+PEI 2 194 11-25-2011
CpeU-I subfamily Cyan7822_4040 YP_003889240.1 Cyanothece sp. PCC7822 PC+PEI 2 196 11-25-2011
CpeU-I subfamily AAQ63051 AAQ63051.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 orf2 in pebAB operon. N-term shortened (14 aa removed: MKCEVSSHFIRGAV) 195 09-16-2012
CpeU-I subfamily glr1259 NP_924205.1 Gloeobacter violaceus PCC7421 PC+PEI 2 197 11-25-2011
CpeU-I subfamily GL6909_3539 Gloeothece sp. PCC6909/1 PC+PEI 2 190 11-25-2011
CpeU-I subfamily Npun_R0731 YP_001864426.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 191 11-25-2011
CpeU-I subfamily Tery_4111 YP_723592.1 Trichodesmium erythraeum IMS101 PC+PEI 193 11-25-2011
CpeU-I subfamily LYNGBM3L_55920 ZP_08427738.1 Lyngbya majuscula 3L PC+PEI 2 197 11-25-2011
CpeU-I subfamily MICAI_380008 ZP_10229445.1 Microcystis sp. T1-4 PC+PEI 2 196 08-22-2012
CpeU-I subfamily Osc7112_1019 YP_007113993.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 196 04-29-2013
CpeU-I subfamily Cal6303_1003 YP_007136040.1 Calothrix sp. PCC6303 PC+PEI 2 202 04-29-2013
CpeU-I subfamily Osc10802DRAFT_3769 Oscillatoria sp. PCC10802 PC+PEI 198 06-12-2013
CpeU-I subfamily Ple7327_2703 YP_007081540.1 Pleurocapsa sp. PCC7327 PC+PEI 176 04-22-2013
CpeU-I subfamily Ple7327_1060 YP_007080032.1 Pleurocapsa sp. PCC7327 PC+PEI 195 04-24-2013
CpeU-I subfamily GLO73106DRAFT_00035880 ZP_21049296.1 Gloeocapsa sp. PCC73106 PC+PEI 181 04-24-2013
CpeU-I subfamily Lepto7376_3000 YP_007072075.1 Leptolyngbya sp. PCC7376 PC+PEI 191 04-24-2013
CpeU-I subfamily Sta7437_0247 YP_007130830.1 Stanieria cyanosphaera PCC7437 PC+PEI 187 04-29-2013
CpeU-I subfamily Xen7305DRAFT_00018880 ZP_21056337.1 Xenococcus sp. PCC7305 PC+PEI 187 04-29-2013
CpeU-I subfamily Mic7113_4742 YP_007123821.1 Microcoleus sp. PCC7113 PC+PEI 2 204 04-24-2013
CpeU-I subfamily Cha6605_4060 YP_007098543.1 Chamaesiphon minutus PCC6605 PC+PEI 186 04-29-2013
CpeU-I subfamily ZP_18907671 ZP_18907671.1 Leptolyngbya sp. PCC7375 PC+PEI 2 196 04-24-2013
CpeU-I subfamily Pse7367_3939 YP_007083590.1 Pseudanabaena sp. PCC7367 PC+PEI 197 04-29-2013
CpeU-II subfamily sync_0492 YP_729719.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 200 11-25-2011
CpeU-II subfamily Syncc9605_0424 YP_380755.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 203 11-25-2011
CpeU-II subfamily SH8109_0086 ZP_05788514.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 203 11-25-2011
CpeU-II subfamily SYNW2019 NP_898110.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 204 11-25-2011
CpeU-II subfamily Syncc9902_1905 YP_377906.1 Synechococcus sp. CC9902 PC+PEI+PEII 3dA/CA4-A 205 11-25-2011
CpeU-II subfamily BL107_08896 ZP_01469882.1 Synechococcus sp. BL107 PC+PEI+PEII 3dA/CA4-A N-term extended (8 aa added) 205 09-17-2012
CpeU-II subfamily SynWH7803_0483 YP_001224206.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a possible alternative start would make the sequence 2 aa longer (MP) 201 09-17-2012
CpeU-II subfamily WH7805_06731 ZP_01123346.1 Synechococcus sp. WH7805 PC+PEI 2 N-term extended (8 aa added) 193 09-17-2012
CpeU-II subfamily RS9916_40166 ZP_01473076.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A N-term extended (10 aa added) 208 09-17-2012
CpeU-II subfamily SynRCC307_2060 YP_001228316.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA 202 11-25-2011
CpeU-II subfamily SCB02_010100004388 ZP_07970147.1 Synechococcus sp. CB0205 PC+PEI 2 MIVEASFVVPMS not present in refseq 206 11-25-2011
CpeU-II subfamily Syn8016DRAFT_2746 ZP_08957399.1 Synechococcus sp. WH8016 PC+PEI+PEII 3aA N-term shortened by 22aa (METVPTFQSNGPMTVSDSSLEV) 204 11-25-2011
CpeU-II subfamily SynWH8020_CpeUII AAA27342.1 Synechococcus sp. WH8020 PC+PEI+PEII 3dA/CA4-A ORF200 in Wilbanks et al. (1993) 200 08-27-2012
CpcS homologs family S7335_2999 ZP_05036565.1 Synechococcus sp. PCC7335 PC+PEI CA3 190 11-16-2011
CpcS homologs family PCC7424_4989 YP_002380210.1 Cyanothece sp. PCC7424 PC+PEI 2 186 11-16-2011
CpcS homologs family Cyan7822_0350 YP_003885671.1 Cyanothece sp. PCC7822 PC+PEI 2 184 11-16-2011
CpcS homologs family gll1024 NP_923970.1 Gloeobacter violaceus PCC7421 PC+PEI 2 N-term shortened (10 aa removed) 185 08-29-2012
CpcS homologs family GL6909_1261 Gloeothece sp. PCC6909/1 PC+PEI 2 184 11-29-2011
CpcS homologs family L8106_04191 ZP_01624610.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 N-term shortened (13 aa removed) 187 08-29-2012
CpcS homologs family MAE_03120 YP_001655326.1 Microcystis aeruginosa NIES-843 PC 1 184 11-16-2011
CpcS homologs family Synpcc7942_1167 YP_400184.1 Synechococcus elongatus PCC7942 PC 1 185 11-16-2011
CpcS homologs family syc0383_d YP_171093.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 185 11-16-2011
CpcS homologs family CYB_1626 YP_477850.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 184 11-16-2011
CpcS homologs family CYA_1794 YP_475210.1 Synechococcus sp. JA-3-3Ab PC 1 184 11-16-2011
CpcS homologs family IPF_1433 CAO88463.1 Microcystis aeruginosa PCC7806 PC 1 N-term shortened (6 aa removed) 184 08-29-2012
CpcS homologs family LYNGBM3L_16700 ZP_08428241.1 Lyngbya majuscula 3L PC+PEI 2 183 11-16-2011
CpcS homologs family MICAK_4060002 CCI38357.1 Microcystis aeruginosa PCC9701 PC 1 184 08-23-2012
CpcS homologs family MICAG_1770025 CCI22489.1 Microcystis aeruginosa PCC9808 PC 1 184 08-22-2012
CpcS homologs family MICAD_1550046 CCI06176.1 Microcystis aeruginosa PCC7941 PC 1 184 08-23-2012
CpcS homologs family MICAC_5390009 CCI04105.1 Microcystis aeruginosa PCC9443 PC 1 184 08-23-2012
CpcS homologs family MICAB_3150024 CCH97313.1 Microcystis aeruginosa PCC9717 PC 1 184 08-23-2012
CpcS homologs family MICCA_3330013 ZP_18818132.1 Microcystis aeruginosa PCC9432 PC 1 184 04-29-2013
CpcS homologs family MICAI_1950011 ZP_10227308.1 Microcystis sp. T1-4 PC+PEI 2 184 08-22-2012
CpcS homologs family Osc10802DRAFT_5364 Oscillatoria sp. PCC10802 PC+PEI 184 06-12-2013
CpcS homologs family Dacsa_0538 YP_007170678.1 Dactylococcopsis salina PCC8305 186 04-24-2013
CpcS homologs family PCC7418_3216 YP_007169546.1 Halothece sp. PCC7418 PC 186 04-24-2013
CpcS homologs family Ple7327_3413 YP_007082178.1 Pleurocapsa sp. PCC7327 PC+PEI 184 04-24-2013
CpcS homologs family GLO73106DRAFT_00038250 ZP_21049050.1 Gloeocapsa sp. PCC73106 PC+PEI 185 04-24-2013
CpcS homologs family Sta7437_0955 YP_007131503.1 Stanieria cyanosphaera PCC7437 PC+PEI 184 04-29-2013
CpcS homologs family Lep6406DRAFT_00020640 ZP_21046657.1 Leptolyngbya sp. PCC6406 PC+PEC 186 04-29-2013
CpcS homologs family ZP_18907916 ZP_18907916.1 Leptolyngbya sp. PCC7375 PC+PEI 2 185 04-24-2013
CpcS homologs family Pse7367_3944 YP_007083595.1 Pseudanabaena sp. PCC7367 PC+PEI N-term shortened (9 aa) 193 07-02-2013
CpcS homologs family ZP_20934102 ZP_20934102.1 Microcystis aeruginosa TAIHU98 PC 1 184 04-24-2013
CpcV family S7335_3639 ZP_05037201.1 Synechococcus sp. PCC7335 PC+PEI CA3 203 09-26-2011
CpcV family SYNPCC7002_A2772 YP_001736001.1 Synechococcus sp. PCC7002 PC 1 Possible alternative start which would make sequence 28 aa shorter (MPCPGLQENVTIYKLSIDICRSSRSSSP) 202 09-26-2011
CpcV family All5292 NP_489332.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 180 09-26-2011
CpcV family Ava_2542 YP_323052.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 178 09-27-2011
CpcV family Aazo_1048 YP_003720533.1 Anabaena (Nostoc) azollae 0708 PC+PEC 186 09-26-2011
CpcV family PCC7424_0543 YP_002375874.1 Cyanothece sp. PCC7424 PC+PEI 2 179 09-26-2011
CpcV family PCC8801_0182 YP_002370442.1 Cyanothece sp. PCC8801 PC+PEI 2 180 09-26-2011
CpcV family Cyan8802_0177 YP_003135981.1 Cyanothece sp. PCC8802 PC 1 180 09-26-2011
CpcV family Cyan7822_3176 YP_003888405.1 Cyanothece sp. PCC7822 PC+PEI 2 179 09-26-2011
CpcV family FJSC11DRAFT_2876 ZP_08986670.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 178 11-04-2011
CpcV family gll1531 NP_924477.1 Gloeobacter violaceus PCC7421 PC+PEI 2 174 09-26-2011
CpcV family GL6909_1397 Gloeothece sp. PCC6909/1 PC+PEI 2 179 05-31-2011
CpcV family L8106_20770 ZP_01622676.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 179 09-26-2011
CpcV family MAE_43410 YP_001659355.1 Microcystis aeruginosa NIES-843 PC 1 179 09-26-2011
CpcV family N9414_09601 ZP_01632591.1 Nodularia spumigena CCY9414 PC 1 180 09-26-2011
CpcV family Npun_R5841 YP_001869082.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 180 09-26-2011
CpcV family Synpcc7942_0364 YP_399383.1 Synechococcus elongatus PCC7942 PC 1 183 09-26-2011
CpcV family syc1149_c YP_171859.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 183 09-26-2011
CpcV family IPF_3889 CAO91269.1 Microcystis aeruginosa PCC7806 PC 1 179 10-20-2011
CpcV family CRC_02537 ZP_06309054.1 Cylindrospermopsis raciborskii CS-505 PC 1 178 10-19-2011
CpcV family CRD_01019 ZP_06304158.1 Raphidiopsis brookii D9 PC 1 178 10-19-2011
CpcV family MICAK_2740002 CCI36804.1 Microcystis aeruginosa PCC9701 PC 1 179 08-23-2012
CpcV family MICAG_130027 CCI21366.1 Microcystis aeruginosa PCC9808 PC 1 179 08-22-2012
CpcV family MICAD_2990036 CCI08086.1 Microcystis aeruginosa PCC7941 PC 1 179 08-23-2012
CpcV family MICAC_6140009 CCI04940.1 Microcystis aeruginosa PCC9443 PC 1 179 08-23-2012
CpcV family MICAB_580007 CCH99120.1 Microcystis aeruginosa PCC9717 PC 1 179 08-23-2012
CpcV family MICCA_960048 ZP_18815548.1 Microcystis aeruginosa PCC9432 PC 1 179 04-29-2013
CpcV family MICAI_660015 ZP_10230065.1 Microcystis sp. T1-4 PC+PEI 2 179 08-22-2012
CpcV family Scytonema_PCC7110_joined_9349 Scytonema hofmanni PCC7110 PC+PEC 190 06-12-2013
CpcV family FisPCC73103_2832 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 178 06-12-2013
CpcV family FisPCC7414_2733 Fischerella muscicola PCC7414 PC+PEC 178 06-12-2013
CpcV family Fischerella_sp._PCC7521_3976 Fischerella thermalis PCC7521 PC+PEC 178 06-12-2013
CpcV family Chloroglopsis_PCC9212_joined_3827 Chlorogloeopsis sp. PCC9212 PC+PEC 196 06-12-2013
CpcV family UYC_07367 Chlorogloeopsis fritschii PCC6912 PC+PEC 196 06-12-2013
CpcV family Cal6303_4023 YP_007138911.1 Calothrix sp. PCC6303 PC+PEI 2 180 04-29-2013
CpcV family Cal7507_0808 YP_007064126.1 Calothrix sp. PCC7507 PC+PEC 180 04-29-2013
CpcV family Osc10802DRAFT_3493 Oscillatoria sp. PCC10802 PC+PEI 178 06-12-2013
CpcV family Oscil6304_1493 YP_007085118.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 179 04-29-2013
CpcV family FIS9605DRAFT_06446 Fischerella sp. PCC9605 PC+PEC 176 06-12-2013
CpcV family Fis9431DRAFT_0656 Fischerella sp. PCC9431 PC+PEC 178 06-12-2013
CpcV family PCC9339DRAFT_05124 Fischerella sp. PCC9339 PC+PEC 178 06-12-2013
CpcV family Nos7524_2791 YP_007076213.1 Nostoc sp. PCC7524 PC+PEC 180 04-23-2013
CpcV family Nos7107_4105 YP_007051806.1 Nostoc sp. PCC7107 PC+PEC 179 04-29-2013
CpcV family Cylst_5166 YP_007149887.1 Cylindrospermum stagnale PCC7417 PC+PEC 180 04-23-2013
CpcV family Anacy_2625 YP_007156976.1 Anabaena cylindrica PCC7122 PC+PEC 180 04-23-2013
CpcV family Ana7108_1911 Anabaena sp. PCC7108 PC+PEC 180 06-12-2013
CpcV family Riv7116_0828 YP_007053959.1 Rivularia sp. PCC7116 PC+PEC 180 04-23-2013
CpcV family Syn7509DRAFT_00027440 ZP_21040864.1 Synechocystis sp. PCC7509 PC 185 04-23-2013
CpcV family Glo7428_0828 YP_007126571.1 Gloeocapsa sp. PCC7428 PC 179 04-23-2013
CpcV family Chro_2758 YP_007092096.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 182 04-23-2013
CpcV family Dacsa_3059 YP_007172949.1 Dactylococcopsis salina PCC8305 178 04-23-2013
CpcV family PCC7418_0245 YP_007166696.1 Halothece sp. PCC7418 PC 178 04-23-2013
CpcV family Ple7327_1943 YP_007080842.1 Pleurocapsa sp. PCC7327 PC+PEI N-term shortened (12 aa) 179 07-02-2013
CpcV family GLO73106DRAFT_00007680 ZP_21052075.1 Gloeocapsa sp. PCC73106 PC+PEI 176 04-23-2013
CpcV family Lepto7376_3174 YP_007072237.1 Leptolyngbya sp. PCC7376 PC+PEI 176 04-23-2013
CpcV family Sta7437_3035 YP_007133519.1 Stanieria cyanosphaera PCC7437 PC+PEI 180 04-29-2013
CpcV family Xen7305DRAFT_00016660 ZP_21056473.1 Xenococcus sp. PCC7305 PC+PEI 181 04-23-2013
CpcV family Mic7113_6350 YP_007125343.1 Microcoleus sp. PCC7113 PC+PEI 2 181 04-23-2013
CpcV family Cha6605_0407 YP_007095229.1 Chamaesiphon minutus PCC6605 PC+PEI 182 04-29-2013
CpcV family Lep6406DRAFT_00020650 ZP_21046658.1 Leptolyngbya sp. PCC6406 PC+PEC 178 04-29-2013
CpcV family ZP_18907669 ZP_18907669.1 Leptolyngbya sp. PCC7375 PC+PEI 2 177 04-23-2013
CpcV family GEI7407_3497 YP_007111016.1 Geitlerinema sp. PCC7407 PC 179 04-29-2013
CpcV family LepboDRAFT_0977 Leptolyngbya boryana PCC6306 PC 179 06-11-2013
CpcV family Pse7367_3862 YP_007083521.1 Pseudanabaena sp. PCC7367 PC+PEI 201 04-23-2013
CpcV family ZP_20934830 ZP_20934830.1 Microcystis aeruginosa TAIHU98 PC 1 179 04-23-2013
CpcT family WH7805_06621 ZP_01123324.1 Synechococcus sp. WH7805 PC+PEI 2 213 09-26-2011
CpcT family RS9917_02858 ZP_01080754.1 Synechococcus sp. RS9917 PC 1 197 09-26-2011
CpcT family RS9916_40316 DS022299.1 Synechococcus sp. RS9916 PC+PEI+PEII 3dA/CA4-A RS9916 possesses both cpcT and RpcT 198 05-27-2014
CpcT family WH5701_05945 ZP_01083809.1 Synechococcus sp. WH5701 PC 1 201 09-26-2011
CpcT family SynRCC307_2033 YP_001228289.1 Synechococcus sp. RCC307 PC+PEI+PEII 3eA No rpcT 201 09-26-2011
CpcT family SCB01_010100012985 ZP_07974577.1 Synechococcus sp. CB0101 PC 1 197 11-04-2011
CpcT family CB0205_0884 Synechococcus sp. CB0205 PC+PEI 2 Gene was not modelled. Sequence not in refseq. 196 09-19-2012
CpcT family S7335_2352 ZP_05035920.1 Synechococcus sp. PCC7335 PC+PEI CA3 196 09-26-2011
CpcT family SYNPCC7002_A2095 YP_001735334.1 Synechococcus sp. PCC7002 PC 1 199 09-26-2011
CpcT family CPCC7001_2615 ZP_05046425.1 Cyanobium sp. PCC7001 PC 1 204 09-26-2011
CpcT family slr1649 NP_441787.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 196 09-26-2011
CpcT family AM1_C0119 YP_001521565.1 Acaryochloris marina MBIC11017 (AM1) PC 1 on preb3 plasmid 197 09-26-2011
CpcT family all5339 NP_489379.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC Crystal structures of CpcT from Nostoc sp. PCC7120 and its complex with PCB were determined at 1.95 and 2.50 Å resolution, respectively (Zhou et al. 2014). 199 10-23-2014
CpcT family Ava_2579 YP_323089.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 199 09-27-2011
CpcT family Aazo_2275 YP_003721374.1 Anabaena (Nostoc) azollae 0708 PC+PEC 198 09-26-2011
CpcT family AmaxDRAFT_0741 ZP_03271923.1 Arthrospira (Spirulina) maxima CS-328 PC 1 198 09-26-2011
CpcT family CwatDRAFT_4238 ZP_00515713.1 Crocosphaera watsonii WH8501 PC+PEI 196 09-26-2011
CpcT family cce_1380 YP_001802796.1 Cyanothece sp. ATCC51142 PC 1 196 09-26-2011
CpcT family PCC7424_3679 YP_002378930.1 Cyanothece sp. PCC7424 PC+PEI 2 195 09-26-2011
CpcT family Cyan7425_0272 YP_002481027.1 Cyanothece sp. PCC7425 PC 1 196 09-26-2011
CpcT family PCC8801_1383 YP_002371599.1 Cyanothece sp. PCC8801 PC+PEI 2 196 09-26-2011
CpcT family Cyan8802_1417 YP_003137169.1 Cyanothece sp. PCC8802 PC 1 196 09-26-2011
CpcT family CY0110_13236 ZP_01728983.1 Cyanothece sp. CCY0110 PC 1 196 09-26-2011
CpcT family Cyan7822_5091 YP_003890251.1 Cyanothece sp. PCC7822 PC+PEI 2 195 09-26-2011
CpcT family FJSC11DRAFT_1806 ZP_08985600.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 196 11-04-2011
CpcT family glr1182 NP_924128.1 Gloeobacter violaceus PCC7421 PC+PEI 2 202 11-01-2012
CpcT family GL6909_5526 Gloeothece sp. PCC6909/1 PC+PEI 2 199 06-01-2011
CpcT family L8106_16979 ZP_01620427.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 196 09-26-2011
CpcT family MC7420_6399 ZP_05026218.1 Microcoleus chthonoplastes PCC7420 PC+PEC 196 09-26-2011
CpcT family MAE_07320 YP_001655746.1 Microcystis aeruginosa NIES-843 PC 1 194 09-26-2011
CpcT family N9414_11904 ZP_01632483.1 Nodularia spumigena CCY9414 PC 1 196 09-26-2011
CpcT family Npun_F0744 YP_001864439.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 197 09-26-2011
CpcT family Synpcc7942_0800 YP_399819.1 Synechococcus elongatus PCC7942 PC 1 197 08-28-2012
CpcT family syc0738_d YP_171448.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 197 09-26-2011
CpcT family CYB_2741 YP_478929.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 paralog of CYB_1028 199 09-17-2012
CpcT family CYB_1028 YP_477269.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 CpcT paralog 218 09-17-2012
CpcT family CYA_2044 YP_475447.1 Synechococcus sp. JA-3-3Ab PC 1 199 08-24-2012
CpcT family CYA_2568 YP_475950.1 Synechococcus sp. JA-3-3Ab PC 1 Paralog of CYA_2044 198 08-24-2012
CpcT family tlr2156 NP_682946.1 Thermosynechococcus elongatus BP-1 PC 1 196 09-26-2011
CpcT family Tery_5043 YP_724425.1 Trichodesmium erythraeum IMS101 PC+PEI 195 09-26-2011
CpcT family CMK263C Cyanidioschyzon merolae 10D PC 1 found by tblastn 263 02-21-2012
CpcT family GTHECHR1104 XP_001713602.1 Guillardia theta CCMP2712 Cr-PE 545 n.a. Low protoscan score but best BLASTP match to the CpcT family. This cpcT-like gene was characterized by complementation of Synechocystis sp. PCC6803 cpcT (Bolte et al. 2008). However, since G. theta possesses PE (Cr-PE 545) not PC, the function of this gene (despite its closest similarity to cpcT than cpeT families) must likely be to attach a PEB at Cys-159 of beta-PE. 222 09-28-2012
CpcT family IPF_3622 CAO90908.1 Microcystis aeruginosa PCC7806 PC 1 194 10-20-2011
CpcT family NIES39_A06470 BAI88485.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 198 10-20-2011
CpcT family MicvaDRAFT_3520 ZP_08493427.1 Microcoleus vaginatus FGP-2 PC 1 196 10-20-2011
CpcT family LYNGBM3L_15770 ZP_08426266.1 Lyngbya majuscula 3L PC+PEI 2 204 10-19-2011
CpcT family OSCI_3240023 ZP_07111793.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 196 10-19-2011
CpcT family CRC_00081 ZP_06306777.1 Cylindrospermopsis raciborskii CS-505 PC 1 197 10-19-2011
CpcT family CRD_00828 ZP_06303865.1 Raphidiopsis brookii D9 PC 1 197 10-19-2011
CpcT family PCC_0629 YP_002049265.1 Paulinella chromatophora M0880 PC 1 201 09-19-2012
CpcT family Cy51472DRAFT_1191 ZP_08972395.1 Cyanothece sp. ATCC51472 PC 1 196 01-10-2012
CpcT family AplaP_010100001895 ZP_06380416.1 Arthrospira (Spirulina) platensis Paraca PC 1 198 01-24-2012
CpcT family HAN_1g134 XP_001712298.1 Hemiselmis andersenii CCMP644 Cr-PE 555 n.a. 221 01-24-2012
CpcT family CWATWH0003_2153 EHJ13154.1 Crocosphaera watsonii WH0003 PC+PEI 196 02-22-2012
CpcT family MICAK_250007 CCI36480.1 Microcystis aeruginosa PCC9701 PC 1 194 08-23-2012
CpcT family MICAG_360013 CCI27632.1 Microcystis aeruginosa PCC9808 PC 1 194 08-22-2012
CpcT family MICAD_2070012 CCI06782.1 Microcystis aeruginosa PCC7941 PC 1 194 08-23-2012
CpcT family MICAC_2140007 CCI01493.1 Microcystis aeruginosa PCC9443 PC 1 194 08-23-2012
CpcT family MICAB_7270009 CCI00103.1 Microcystis aeruginosa PCC9717 PC 1 194 08-23-2012
CpcT family MICCA_210007 ZP_18814405.1 Microcystis aeruginosa PCC9432 PC 1 194 04-29-2013
CpcT family MICAI_2810005 ZP_10228696.1 Microcystis sp. T1-4 PC+PEI 2 194 08-22-2012
CpcT family Osc7112_1339 YP_007114287.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 196 04-23-2013
CpcT family Scytonema_PCC7110_joined_8455 Scytonema hofmanni PCC7110 PC+PEC 196 06-12-2013
CpcT family FisPCC73103_5898 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 196 06-12-2013
CpcT family FisPCC7414_5831 Fischerella muscicola PCC7414 PC+PEC 196 06-12-2013
CpcT family Fischerella_sp._PCC7521_5043 Fischerella thermalis PCC7521 PC+PEC 196 06-12-2013
CpcT family Chloroglopsis_PCC9212_joined_4222 Chlorogloeopsis sp. PCC9212 PC+PEC 195 06-12-2013
CpcT family UYC_07788 Chlorogloeopsis fritschii PCC6912 PC+PEC 196 06-12-2013
CpcT family Cal6303_1725 YP_007136735.1 Calothrix sp. PCC6303 PC+PEI 2 197 04-29-2013
CpcT family Cal7507_4092 YP_007067308.1 Calothrix sp. PCC7507 PC+PEC 199 04-29-2013
CpcT family Osc10802DRAFT_6034 Oscillatoria sp. PCC10802 PC+PEI N-term shortened (22 aa) 198 07-02-2013
CpcT family Oscil6304_5951 YP_007089334.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 198 04-29-2013
CpcT family FIS9605DRAFT_01268 Fischerella sp. PCC9605 PC+PEC 196 06-12-2013
CpcT family Fis9431DRAFT_1538 Fischerella sp. PCC9431 PC+PEC 196 06-12-2013
CpcT family PCC9339DRAFT_02937 Fischerella sp. PCC9339 PC+PEC 196 06-12-2013
CpcT family Nos7524_5510 YP_007078819.1 Nostoc sp. PCC7524 PC+PEC 198 04-23-2013
CpcT family Nos7107_3253 YP_007050989.1 Nostoc sp. PCC7107 PC+PEC 196 04-29-2013
CpcT family Cylst_2544 YP_007147432.1 Cylindrospermum stagnale PCC7417 PC+PEC 198 04-23-2013
CpcT family Anacy_3145 YP_007157465.1 Anabaena cylindrica PCC7122 PC+PEC N-term shortened (12 aa) 200 07-02-2013
CpcT family Ana7108_4567 Anabaena sp. PCC7108 PC+PEC 200 06-12-2013
CpcT family Riv7116_4869 YP_007057827.1 Rivularia sp. PCC7116 PC+PEC 196 04-23-2013
CpcT family Syn7509DRAFT_00027490 ZP_21040869.1 Synechocystis sp. PCC7509 PC 197 04-23-2013
CpcT family Glo7428_1581 YP_007127302.1 Gloeocapsa sp. PCC7428 PC N-term shortened (21 aa) 196 07-02-2013
CpcT family Chro_1061 YP_007090462.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 197 04-23-2013
CpcT family Dacsa_1263 YP_007171317.1 Dactylococcopsis salina PCC8305 197 04-23-2013
CpcT family PCC7418_2907 YP_007169251.1 Halothece sp. PCC7418 PC 198 04-23-2013
CpcT family Ple7327_1905 YP_007080807.1 Pleurocapsa sp. PCC7327 PC+PEI 196 04-23-2013
CpcT family GLO73106DRAFT_00031830 ZP_21049676.1 Gloeocapsa sp. PCC73106 PC+PEI 195 04-23-2013
CpcT family Lepto7376_0226 YP_007069504.1 Leptolyngbya sp. PCC7376 PC+PEI 197 06-20-2013
CpcT family Cyast_1789 YP_007165394.1 Cyanobacterium stanieri PCC7202 PC 194 04-23-2013
CpcT family Cyan10605_2163 YP_007162293.1 Cyanobacterium aponimum PCC10605 194 04-29-2013
CpcT family Sta7437_3561 YP_007134025.1 Stanieria cyanosphaera PCC7437 PC+PEI 197 04-29-2013
CpcT family Xen7305DRAFT_00011110 ZP_21057060.1 Xenococcus sp. PCC7305 PC+PEI 194 04-23-2013
CpcT family Mic7113_5097 YP_007124160.1 Microcoleus sp. PCC7113 PC+PEI 2 196 04-23-2013
CpcT family Cri9333_1163 YP_007141578.1 Crinalium epipsammum PCC9333 PC 196 04-29-2013
CpcT family Cha6605_4079 YP_007098562.1 Chamaesiphon minutus PCC6605 PC+PEI 203 04-29-2013
CpcT family Cyagr_1634 YP_007046126.1 Cyanobium gracile PCC6307 PC 197 04-29-2013
CpcT family Lep6406DRAFT_00020660 ZP_21046659.1 Leptolyngbya sp. PCC6406 PC+PEC 197 04-29-2013
CpcT family ZP_18907915 ZP_18907915.1 Leptolyngbya sp. PCC7375 PC+PEI 2 196 04-23-2013
CpcT family GEI7407_0661 YP_007108211.1 Geitlerinema sp. PCC7407 PC 197 04-29-2013
CpcT family LepboDRAFT_3110 Leptolyngbya boryana PCC6306 PC 196 06-11-2013
CpcT family Syn6312_0929 YP_007060674.1 Synechococcus sp. PCC6312 PC N-term shortened (14 aa) 198 07-02-2013
CpcT family Syn7502_02517 YP_007106625.1 Synechococcus sp. PCC7502 PC 197 06-20-2013
CpcT family Pse7429DRAFT_1715 ZP_21065875.1 Pseudanabaena sp. (biceps) PCC7429 PC 214 06-20-2013
CpcT family Pse7367_2699 YP_007103382.1 Pseudanabaena sp. PCC7367 PC+PEI Low protomatch score 202 06-20-2013
CpcT family ZP_20934508 ZP_20934508.1 Microcystis aeruginosa TAIHU98 PC 1 194 04-23-2013
CpeT family sync_0509 YP_729736.1 Synechococcus sp. CC9311 PC+PEI+PEII 3dA/CA4-A 208 09-26-2011
CpeT family Syncc9605_0440 YP_380771.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 204 09-26-2011
CpeT family SH8109_0065 ZP_05789950.1 Synechococcus sp. WH8109 PC+PEI+PEII 3bB 204 09-26-2011
CpeT family SYNW2003 NP_898094.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 204 09-26-2011
CpeT family Syncc9902_1887 YP_377888.1 Synechococcus sp. CC9902 PC+PEI+PEII