CyanoLyase

MC7420_4701 homologs family

Description

All members of this family possess several PBS lyase HEAT-like repeat domains and a C-term dual specificity phosphatase, catalytic domain.

Gene Locus tag Genbank Species Strain PBP in rods Pigment type Remark Length Last change
MC7420_4701 homologs family MC7420_4701 ZP_05025511.1 Microcoleus chthonoplastes PCC7420 PC+PEC 455 11-30-2011
MC7420_4701 homologs family Cyan7822_1857 YP_003887117.1 Cyanothece sp. PCC7822 PC+PEI 2 457 11-30-2011
MC7420_4701 homologs family MicvaDRAFT_1724 ZP_08491624.1 Microcoleus vaginatus FGP-2 PC 1 Sequence shortened at N-term (104 aa removed: MNSAATLIQQLPELSDAQFHQKYLKQKQGMRTLATILPQVEQQSLALRAVKLALKVNLKLGSKLAGTVKPEFQIATIKLIEKIPTSPLLKIQLLALTSSDMAIP) 534 09-11-2012
MC7420_4701 homologs family MC7420_1061 ZP_05028540.1 Microcoleus chthonoplastes PCC7420 PC+PEC This sequence has a much shorter N-term than others. But not a frameshift. 173 09-11-2012
MC7420_4701 homologs family Osc7112_2212 YP_007115088.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 638 04-24-2013
MC7420_4701 homologs family Osc10802DRAFT_3523 Oscillatoria sp. PCC10802 PC+PEI 550 06-12-2013

Model strain Model strains, Marine strains

Biogenouest Station biologique de Roscoff ANR

Copyright © 2005-2012 Biogenouest® - Legal notice - Contact : Contact GenOuest

Hosted by the GenOuest bioinformatics platform