CyanoLyase

SynW8020_mpeV

Origin

Strain: WH8020

Family: CpeF family

Genbank record: AAA27339.1

Genomic context

Description

Length: 301 aa

Position: 6590 to 7495 on M95288.1

References

  • Wilbanks et al., 1993. Rod structure of a phycoerythrin II-containing phycobilisome. I. Organization and sequence of the gene cluster encoding the major phycobiliprotein rod components in the genome of marine Synechococcus sp. WH8020 J Biol Chem, 268, 1226-1235.

>gi|154559|gb|AAA27339.1|cl|1105 [SynW8020_mpeV] CpeF family in strain WH8020
MSDSNQIKNSSQTQQVNTLSEEEALVLSAHLKEQRSSGIPLDSDQKSIDKMIAGLGDPRGLLRLRFADSLGSVGQAAVPA
LCNAMLSSDQVTVRRAAAKTLTLIEDPNSLPDLVSAFLNDQDSVVQGSAMGAMAAIGEEAVTPILNLLSHPETTEMQIGL
ANWALAFIGDRGSKTLRNALSSGNSTIRKAAIAALTSRIDTLNADENKDLLSNASNDDDSEIRAEVATLLGAMEDTDWAK
LLLISNLDDPDSWVRKNSVLSLMKLNAKEALPKLEELELQEKDRIVVNVLKLAIQKLRQTD
Biogenouest Station biologique de Roscoff ANR

Copyright © 2005-2012 Biogenouest® - Legal notice - Contact : Contact GenOuest

Hosted by the GenOuest bioinformatics platform