CyanoLyase

E/F clan

Description

No structure for E/F clan members has been published to date, but they have similarity to structures of enzymes from other biochemical pathways. They all possess an alpha-alpha superhelix fold and belong to the ARM repeat superfamily. They have variable lengths (150-427 aa) and the family of the closest 3D structure varies accordingly (c3ltjA for the shortest, d1oyza for the middle sized, d1gw5b for the longest). They possess HEAT repeats that may be involved in protein/protein interactions.

Fold

Phyre2 found the following protein folds for this family:

References

  • Schluchter et al., 2010. Phycobiliprotein Biosynthesis in Cyanobacteria: Structure and Function of Enzymes Involved in Post-translational Modification Adv Exp Med Biol, 675, 211-228.

Gene Locus tag Genbank Species Strain PBP in rods Pigment type Remark Length Last change
CpcE/RpcE family WH7805_06756 ZP_01123351.1 Synechococcus sp. WH7805 PC+PEI 2 The R-PC-III present in this strain has a PCB:PEB ratio of 2:1 (Sidler, 1994). It is unclear whether WH7805 has CpcE/F or RpcE/F but the presence of CpcT (and not RpcT) however argues for the following pigmentation: alpha-84=PEB; beta-84=PCB; beta-155=PCB. 265 09-19-2012
CpcE/RpcE family SynRCC307_2066 YP_001228322.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b Unclear whether this strain has CpcE/F or RpcE/F 274 12-06-2011
CpcE/RpcE family S7335_2363 ZP_05035931.1 Synechococcus sp. PCC7335 PC+PEI CA3 CpcEII or RpcE 274 12-06-2011
CpcE-I subfamily alr0532 NP_484576.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 276 12-06-2011
CpcE-I subfamily CwatDRAFT_3431 ZP_00516610.1 Crocosphaera watsonii WH8501 PC+PEI Not clustered with cpcF-I. This strain also possesses an RpcG-like sequence which should act on the same alpha-PC binding site as CpcE/F. 284 10-30-2012
CpcE-I subfamily L8106_02267 ZP_01619122.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 275 09-26-2011
CpcE-I subfamily N9414_13270 ZP_01632751.1 Nodularia spumigena CCY9414 PC 1 Sequence incomplete: lacks C-term (end of contig) 158 01-10-2012
CpcE-I subfamily SYNPCC7002_A2213 YP_001735449.1 Synechococcus sp. PCC7002 PC 1 268 09-26-2011
CpcE-I subfamily slr1878 NP_441003.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 272 09-26-2011
CpcE-I subfamily AM1_C0118 YP_001521564.1 Acaryochloris marina MBIC11017 (AM1) PC 1 on preb3 plasmid 274 09-26-2011
CpcE-I subfamily Ava_2934 YP_323440.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 276 12-06-2011
CpcE-I subfamily Aazo_3485 YP_003722225.1 Anabaena (Nostoc) azollae 0708 PC+PEC 276 12-06-2011
CpcE-I subfamily AmaxDRAFT_0381 ZP_03271564.1 Arthrospira (Spirulina) maxima CS-328 PC 1 291 09-26-2011
CpcE-I subfamily cce_2656 YP_001804070.1 Cyanothece sp. ATCC51142 PC 1 285 09-26-2011
CpcE-I subfamily PCC7424_0156 YP_002375494.1 Cyanothece sp. PCC7424 PC+PEI 2 284 12-06-2011
CpcE-I subfamily Cyan7425_1692 YP_002482422.1 Cyanothece sp. PCC7425 PC 1 276 09-26-2011
CpcE-I subfamily PCC8801_3079 YP_002373216.1 Cyanothece sp. PCC8801 PC+PEI 2 284 12-06-2011
CpcE-I subfamily Cyan8802_3041 YP_003138722.1 Cyanothece sp. PCC8802 PC 1 284 09-26-2011
CpcE-I subfamily Cyan7822_1647 YP_003886912.1 Cyanothece sp. PCC7822 PC+PEI 2 285 12-06-2011
CpcE-I subfamily gi|111610620|gb|ABH11707.1| ABH11707.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 294 12-06-2011
CpcE-I subfamily gi|581258|emb|CAA30066.1| CAA30066.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 275 12-06-2011
CpcE-I subfamily FJSC11DRAFT_0792 ZP_08984586.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 276 12-06-2011
CpcE-I subfamily gvip185 NP_924214.1 Gloeobacter violaceus PCC7421 PC+PEI 2 247 12-06-2011
CpcE-I subfamily GL6909_6154 Gloeothece sp. PCC6909/1 PC+PEI 2 284 12-06-2011
CpcE-I subfamily MC7420_3712 ZP_05028456.1 Microcoleus chthonoplastes PCC7420 PC+PEC 275 12-06-2011
CpcE-I subfamily MAE_27970 YP_001657811.1 Microcystis aeruginosa NIES-843 PC 1 270 09-26-2011
CpcE-I subfamily Npun_F5294 YP_001868558.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 280 12-06-2011
CpcE-I subfamily Synpcc7942_1054 YP_400071.1 Synechococcus elongatus PCC7942 PC 1 273 09-26-2011
CpcE-I subfamily syc0494_c YP_171204.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 273 09-26-2011
CpcE-I subfamily CYB_2736 YP_478924.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 This is a second copy of cpcE (cpcE-2) NOT associated with a cpcF 276 12-06-2011
CpcE-I subfamily CYB_0942 YP_477184.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 250 09-26-2011
CpcE-I subfamily CYA_2040 YP_475443.1 Synechococcus sp. JA-3-3Ab PC 1 This is a second copy of cpcE (cpcE-2) NOT associated with a cpcF 275 12-06-2011
CpcE-I subfamily CYA_0217 YP_473704.1 Synechococcus sp. JA-3-3Ab PC 1 250 09-26-2011
CpcE-I subfamily tlr1961 NP_682751.1 Thermosynechococcus elongatus BP-1 PC 1 276 09-26-2011
CpcE-I subfamily Tery_5047 YP_724428.1 Trichodesmium erythraeum IMS101 PC+PEI We thought it was RpcE: why? 289 12-06-2011
CpcE-I subfamily CRD_01230 ZP_06304367.1 Raphidiopsis brookii D9 PC 1 274 12-06-2011
CpcE-I subfamily PCC_0625 YP_002049261.1 Paulinella chromatophora M0880 PC 1 286 12-05-2011
CpcE-I subfamily CRC_01962 ZP_06308542.1 Cylindrospermopsis raciborskii CS-505 PC 1 274 10-19-2011
CpcE-I subfamily OSCI_2780025 ZP_07110957.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 276 10-19-2011
CpcE-I subfamily LYNGBM3L_16670 ZP_08428232.1 Lyngbya majuscula 3L PC+PEI 2 278 10-19-2011
CpcE-I subfamily ZP_08490943.1 ZP_08490943.1 Microcoleus vaginatus FGP-2 PC 1 279 10-20-2011
CpcE-I subfamily IPF_4760 CAO90470.1 Microcystis aeruginosa PCC7806 PC 1 270 10-20-2011
CpcE-I subfamily NIES39_D02010 BAI89621.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 291 10-20-2011
CpcE-I subfamily CMJ043C Cyanidioschyzon merolae 10D PC 1 Distantly related to cyanobacterial CpcE : many insertions in matching sequences and much longer N-term, found by tblastn 516 02-21-2012
CpcE-I subfamily Cy51472DRAFT_1653 ZP_08972857.1 Cyanothece sp. ATCC51472 PC 1 285 01-10-2012
CpcE-I subfamily AplaP_010100003287 ZP_06380690.1 Arthrospira (Spirulina) platensis Paraca PC 1 291 01-24-2012
CpcE-I subfamily CWATWH0003_3128t1 EHJ12159.1 Crocosphaera watsonii WH0003 PC+PEI Incomplete (end of contig) 212 02-22-2012
CpcE-I subfamily MICAI_2630007 ZP_10228400.1 Microcystis sp. T1-4 PC+PEI 2 270 08-22-2012
CpcE-I subfamily MICAG_2690003 CCI25064.1 Microcystis aeruginosa PCC9808 PC 1 270 08-22-2012
CpcE-I subfamily MICAB_5440004 CCH98842.1 Microcystis aeruginosa PCC9717 PC 1 270 08-23-2012
CpcE-I subfamily MICAK_2510017 CCI36535.1 Microcystis aeruginosa PCC9701 PC 1 270 08-23-2012
CpcE-I subfamily MICAC_4030008 CCI03035.1 Microcystis aeruginosa PCC9443 PC 1 270 08-23-2012
CpcE-I subfamily MICCA_2170004 ZP_18816838.1 Microcystis aeruginosa PCC9432 PC 1 270 04-22-2013
CpcE-I subfamily MICAD_1130002 CCI05527.1 Microcystis aeruginosa PCC7941 PC 1 270 08-23-2012
CpcE-I subfamily Nos7524_4177 YP_007077540.1 Nostoc sp. PCC7524 PC+PEC 276 04-23-2013
CpcE-I subfamily Ple7327_2230 YP_007081103.1 Pleurocapsa sp. PCC7327 PC+PEI 293 04-23-2013
CpcE-I subfamily Anacy_1900 YP_007156298.1 Anabaena cylindrica PCC7122 PC+PEC 276 04-23-2013
CpcE-I subfamily ZP_20932178 ZP_20932178.1 Microcystis aeruginosa TAIHU98 PC 1 270 04-23-2013
CpcE-I subfamily Cylst_0755 YP_007145762.1 Cylindrospermum stagnale PCC7417 PC+PEC 284 04-23-2013
CpcE-I subfamily Osc7112_2004 YP_007114894.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 279 04-23-2013
CpcE-I subfamily Mic7113_2593 YP_007121792.1 Microcoleus sp. PCC7113 PC+PEI 2 284 04-23-2013
CpcE-I subfamily GLO73106DRAFT_00012720 ZP_21051608.1 Gloeocapsa sp. PCC73106 PC+PEI 275 04-23-2013
CpcE-I subfamily Chro_3411 YP_007092739.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 272 04-23-2013
CpcE-I subfamily Glo7428_4602 YP_007130198.1 Gloeocapsa sp. PCC7428 PC 273 04-23-2013
CpcE-I subfamily Riv7116_3561 YP_007056560.1 Rivularia sp. PCC7116 PC+PEC 275 04-23-2013
CpcE-I subfamily Xen7305DRAFT_00020280 ZP_21056138.1 Xenococcus sp. PCC7305 PC+PEI 271 04-23-2013
CpcE-I subfamily Cyast_0723 YP_007164345.1 Cyanobacterium stanieri PCC7202 PC 275 04-23-2013
CpcE-I subfamily Pse7429DRAFT_3557 ZP_21066937.1 Pseudanabaena sp. (biceps) PCC7429 PC 271 04-23-2013
CpcE-I subfamily Dacsa_0532 YP_007170672.1 Dactylococcopsis salina PCC8305 262 04-23-2013
CpcE-I subfamily Lepto7376_2325 YP_007071446.1 Leptolyngbya sp. PCC7376 PC+PEI 270 04-23-2013
CpcE-I subfamily PCC7418_2470 YP_007168831.1 Halothece sp. PCC7418 PC 263 04-23-2013
CpcE-I subfamily Nos7107_3141 YP_007050881.1 Nostoc sp. PCC7107 PC+PEC 284 04-29-2013
CpcE-I subfamily Cal7507_3703 YP_007066928.1 Calothrix sp. PCC7507 PC+PEC 276 04-29-2013
CpcE-I subfamily Sta7437_0254 YP_007130837.1 Stanieria cyanosphaera PCC7437 PC+PEI 278 04-29-2013
CpcE-I subfamily Oscil6304_1239 YP_007084874.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 281 04-29-2013
CpcE-I subfamily Cal6303_3401 YP_007138308.1 Calothrix sp. PCC6303 PC+PEI 2 N-term shortened (34 aa) 274 07-02-2013
CpcE-I subfamily Lep6406DRAFT_00020730 ZP_21046666.1 Leptolyngbya sp. PCC6406 PC+PEC 267 04-29-2013
CpcE-I subfamily LepboDRAFT_3198 Leptolyngbya boryana PCC6306 PC 278 06-11-2013
CpcE-I subfamily Fis9431DRAFT_3458 Fischerella sp. PCC9431 PC+PEC 276 06-12-2013
CpcE-I subfamily FIS9605DRAFT_06542 Fischerella sp. PCC9605 PC+PEC 276 06-12-2013
CpcE-I subfamily FisPCC73103_3439 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 276 06-12-2013
CpcE-I subfamily Scytonema_PCC7110_joined_1634 Scytonema hofmanni PCC7110 PC+PEC 276 06-12-2013
CpcE-I subfamily Osc10802DRAFT_3759 Oscillatoria sp. PCC10802 PC+PEI 276 06-12-2013
CpcE-I subfamily PCC9339DRAFT_01808 Fischerella sp. PCC9339 PC+PEC 276 06-12-2013
CpcE-I subfamily Ana7108_1540 Anabaena sp. PCC7108 PC+PEC 276 06-12-2013
CpcE-I subfamily Chloroglopsis_PCC9212_joined_2970 Chlorogloeopsis sp. PCC9212 PC+PEC 276 06-12-2013
CpcE-I subfamily UYC_06435 Chlorogloeopsis fritschii PCC6912 PC+PEC 276 06-12-2013
CpcE-I subfamily FisPCC7414_3831 Fischerella muscicola PCC7414 PC+PEC 276 06-12-2013
CpcE-I subfamily Fischerella_sp._PCC7521_721 Fischerella thermalis PCC7521 PC+PEC 276 06-12-2013
CpcE-I subfamily Cyan10605_1973 YP_007162112.1 Cyanobacterium aponimum PCC10605 274 06-12-2013
CpcE-I subfamily Syn6312_2505 YP_007062148.1 Synechococcus sp. PCC6312 PC 292 06-12-2013
CpcE-I subfamily Cha6605_1301 YP_007096023.1 Chamaesiphon minutus PCC6605 PC+PEI 271 06-20-2013
CpcE-I subfamily Pse7367_3924 YP_007083576.1 Pseudanabaena sp. PCC7367 PC+PEI 2 copies? 303 06-20-2013
CpcE-I subfamily ZP_18907676 ZP_18907676.1 Leptolyngbya sp. PCC7375 PC+PEI 2 Low protomatch score 279 06-20-2013
CpcE-I subfamily GEI7407_3506 YP_007111025.1 Geitlerinema sp. PCC7407 PC 279 06-20-2013
CpcE-I subfamily Cri9333_1814 YP_007142209.1 Crinalium epipsammum PCC9333 PC 283 06-20-2013
CpcE-I subfamily Syn7509DRAFT_00024770 ZP_21041085.1 Synechocystis sp. PCC7509 PC 266 06-20-2013
CpcE-I subfamily Syn7502_03299 YP_007107300.1 Synechococcus sp. PCC7502 PC 270 06-20-2013
CpcE-I subfamily Pse7367_2387 YP_007103076.1 Pseudanabaena sp. PCC7367 PC+PEI 2 copies? 273 06-20-2013
CpcE-II subfamily SCB01_010100012952 ZP_07974572.1 Synechococcus sp. CB0101 PC 1 MGPAAMAASPSPSFWA removed at the beginning 290 12-06-2011
CpcE-II subfamily SCB02_010100004415 ZP_07970152.1 Synechococcus sp. CB0205 PC+PEI 2 275 12-06-2011
CpcE-II subfamily RS9917_02908 ZP_01080764.1 Synechococcus sp. RS9917 PC 1 285 12-06-2011
CpcE-II subfamily WH5701_05890 ZP_01083798.1 Synechococcus sp. WH5701 PC 1 282 12-06-2011
CpcE-II subfamily CPCC7001_1137 ZP_05044949.1 Cyanobium sp. PCC7001 PC 1 274 12-06-2011
CpcE-II subfamily Cyagr_1640 YP_007046132.1 Cyanobium gracile PCC6307 PC 273 04-29-2013
RpcE subfamily sync_0486 YP_729713.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 N-term extended 265 09-28-2012
RpcE subfamily SH8109_0092 ZP_05789298.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b Sequence was incomplete (updated by FP) 257 12-05-2011
RpcE subfamily Syncc9902_1911 YP_377912.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 256 09-26-2011
RpcE subfamily SynWH7803_0477 YP_001224200.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 256 09-26-2011
RpcE subfamily Syn8016DRAFT_2740 ZP_08957393.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 269 11-04-2011
RpcE subfamily SynWH8020_rpcE AAA27348.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 265 08-26-2012
CpcF/RpcF family WH7805_06761 ZP_01123352.1 Synechococcus sp. WH7805 PC+PEI 2 Unclear whether this strain has CpcE/F or RpcE/F. Two possibilities:
a-84 and b-84 = PCB; b-155 = PEB
a-84 = PEB,b-84 and b-155 = PCB
212 12-06-2011
CpcF/RpcF family SynRCC307_2067 YP_001228323.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b Unclear whether this strain has CpcE/F or RpcE/F 218 12-06-2011
CpcF/RpcF family S7335_4405 ZP_05037964.1 Synechococcus sp. PCC7335 PC+PEI CA3 CpcFII or RpcF 225 12-06-2011
CpcF-I subfamily alr0533 NP_484577.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 200 12-06-2011
CpcF-I subfamily CwatDRAFT_6054 ZP_00513615.1 Crocosphaera watsonii WH8501 PC+PEI Not clustered with cpcE-I. This strain also possesses an RpcG-like sequence which should act on the same alpha-PC binding site as CpcE/F. 194 10-30-2012
CpcF-I subfamily L8106_02272 ZP_01619123.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 211 09-26-2011
CpcF-I subfamily MC7420_3666 ZP_05028410.1 Microcoleus chthonoplastes PCC7420 PC+PEC 216 12-06-2011
CpcF-I subfamily N9414_13265 ZP_01631845.1 Nodularia spumigena CCY9414 PC 1 198 09-26-2011
CpcF-I subfamily SYNPCC7002_A2214 YP_001735450.1 Synechococcus sp. PCC7002 PC 1 213 09-26-2011
CpcF-I subfamily sll1051 NP_439974.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 214 09-26-2011
CpcF-I subfamily AM1_C0272 YP_001521703.1 Acaryochloris marina MBIC11017 (AM1) PC 1 on preb3 plasmid 217 09-26-2011
CpcF-I subfamily Ava_2935 YP_323441.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 200 12-06-2011
CpcF-I subfamily Aazo_3484 YP_003722224.1 Anabaena (Nostoc) azollae 0708 PC+PEC 203 12-06-2011
CpcF-I subfamily AmaxDRAFT_0380 ZP_03271563.1 Arthrospira (Spirulina) maxima CS-328 PC 1 210 09-26-2011
CpcF-I subfamily cce_2308 YP_001803724.1 Cyanothece sp. ATCC51142 PC 1 215 09-26-2011
CpcF-I subfamily PCC7424_0661 YP_002375988.1 Cyanothece sp. PCC7424 PC+PEI 2 215 12-06-2011
CpcF-I subfamily Cyan7425_1691 YP_002482421.1 Cyanothece sp. PCC7425 PC 1 209 09-26-2011
CpcF-I subfamily PCC8801_3073 YP_002373210.1 Cyanothece sp. PCC8801 PC+PEI 2 215 12-06-2011
CpcF-I subfamily Cyan8802_3047 YP_003138728.1 Cyanothece sp. PCC8802 PC 1 215 09-26-2011
CpcF-I subfamily CY0110_25371 ZP_01730772.1 Cyanothece sp. CCY0110 PC 1 220 09-26-2011
CpcF-I subfamily Cyan7822_2446 YP_003887696.1 Cyanothece sp. PCC7822 PC+PEI 2 226 12-06-2011
CpcF-I subfamily gi|111610621|gb|ABH11708.1| ABH11708.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 273 12-06-2011
CpcF-I subfamily FJSC11DRAFT_0791 ZP_08984585.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 205 12-06-2011
CpcF-I subfamily gvip186 NP_924215.1 Gloeobacter violaceus PCC7421 PC+PEI 2 193 12-06-2011
CpcF-I subfamily GL6909_0679 Gloeothece sp. PCC6909/1 PC+PEI 2 220 12-06-2011
CpcF-I subfamily MAE_27950 YP_001657809.1 Microcystis aeruginosa NIES-843 PC 1 207 09-26-2011
CpcF-I subfamily Npun_F5295 YP_001868559.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 241 12-06-2011
CpcF-I subfamily Synpcc7942_1055 YP_400072.1 Synechococcus elongatus PCC7942 PC 1 207 09-26-2011
CpcF-I subfamily syc0493_c YP_171203.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 207 09-26-2011
CpcF-I subfamily CYB_0943 YP_477185.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 N-term shortened: 16 aa removed by FP (MPLISGFKCTFDYSLP) 213 09-26-2011
CpcF-I subfamily CYA_0216 YP_473703.1 Synechococcus sp. JA-3-3Ab PC 1 N-term shortened: 25 aa removed by FP (MGLSPPIGSLGCFVSFLLTLASGLS) 213 09-26-2011
CpcF-I subfamily tlr1962 NP_682752.1 Thermosynechococcus elongatus BP-1 PC 1 213 09-26-2011
CpcF-I subfamily Tery_5046 YP_724427.1 Trichodesmium erythraeum IMS101 PC+PEI We thought it was RpcF, why? 214 12-06-2011
CpcF-I subfamily CRD_01231 ZP_06304368.1 Raphidiopsis brookii D9 PC 1 216 12-06-2011
CpcF-I subfamily PCC_0624 YP_002049260.1 Paulinella chromatophora M0880 PC 1 224 12-05-2011
CpcF-I subfamily CRC_01963 ZP_06308543.1 Cylindrospermopsis raciborskii CS-505 PC 1 216 10-19-2011
CpcF-I subfamily OSCI_2780026 ZP_07110958.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 209 10-19-2011
CpcF-I subfamily LYNGBM3L_16650 ZP_08428231.1 Lyngbya majuscula 3L PC+PEI 2 212 10-19-2011
CpcF-I subfamily ZP_08490942.1 ZP_08490942.1 Microcoleus vaginatus FGP-2 PC 1 208 10-20-2011
CpcF-I subfamily IPF_4758 CAO90472.1 Microcystis aeruginosa PCC7806 PC 1 207 10-20-2011
CpcF-I subfamily NIES39_D02000 BAI89620.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 210 10-20-2011
CpcF-I subfamily CMJ044C Cyanidioschyzon merolae 10D PC 1 found by tblastn 312 02-21-2012
CpcF-I subfamily Cy51472DRAFT_1994 ZP_08973198.1 Cyanothece sp. ATCC51472 PC 1 215 01-10-2012
CpcF-I subfamily AplaP_010100003292 ZP_06380691.1 Arthrospira (Spirulina) platensis Paraca PC 1 210 01-24-2012
CpcF-I subfamily CWATWH0003_3385 EHJ11901.1 Crocosphaera watsonii WH0003 PC+PEI 212 02-22-2012
CpcF-I subfamily MICAI_2630009 ZP_10228402.1 Microcystis sp. T1-4 PC+PEI 2 207 08-22-2012
CpcF-I subfamily MICAG_2680028 CCI25051.1 Microcystis aeruginosa PCC9808 PC 1 207 08-22-2012
CpcF-I subfamily MICAB_5440002 CCH98840.1 Microcystis aeruginosa PCC9717 PC 1 207 08-23-2012
CpcF-I subfamily MICAK_2510015 CCI36533.1 Microcystis aeruginosa PCC9701 PC 1 207 08-23-2012
CpcF-I subfamily MICAC_4070001 CCI03038.1 Microcystis aeruginosa PCC9443 PC 1 207 08-23-2012
CpcF-I subfamily MICCA_2150045 ZP_18816833.1 Microcystis aeruginosa PCC9432 PC 1 207 04-22-2013
CpcF-I subfamily MICAD_1110027 CCI05522.1 Microcystis aeruginosa PCC7941 PC 1 207 08-23-2012
CpcF-I subfamily Osc7112_2003 YP_007114893.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 208 04-23-2013
CpcF-I subfamily Ple7327_3797 YP_007082522.1 Pleurocapsa sp. PCC7327 PC+PEI 240 04-23-2013
CpcF-I subfamily Nos7524_4178 YP_007077541.1 Nostoc sp. PCC7524 PC+PEC 200 04-23-2013
CpcF-I subfamily ZP_18907677 ZP_18907677.1 Leptolyngbya sp. PCC7375 PC+PEI 2 213 04-23-2013
CpcF-I subfamily Mic7113_2594 YP_007121793.1 Microcoleus sp. PCC7113 PC+PEI 2 213 04-23-2013
CpcF-I subfamily ZP_20932486 ZP_20932486.1 Microcystis aeruginosa TAIHU98 PC 1 207 04-23-2013
CpcF-I subfamily Cylst_0756 YP_007145763.1 Cylindrospermum stagnale PCC7417 PC+PEC 200 04-23-2013
CpcF-I subfamily Anacy_1901 YP_007156299.1 Anabaena cylindrica PCC7122 PC+PEC 200 04-23-2013
CpcF-I subfamily Glo7428_4601 YP_007130197.1 Gloeocapsa sp. PCC7428 PC 208 04-23-2013
CpcF-I subfamily Lepto7376_2326 YP_007071447.1 Leptolyngbya sp. PCC7376 PC+PEI 221 04-23-2013
CpcF-I subfamily Cyast_1932 YP_007165534.1 Cyanobacterium stanieri PCC7202 PC 213 04-23-2013
CpcF-I subfamily Riv7116_3560 YP_007056559.1 Rivularia sp. PCC7116 PC+PEC 206 04-23-2013
CpcF-I subfamily Pse7429DRAFT_3558 ZP_21066938.1 Pseudanabaena sp. (biceps) PCC7429 PC 282 04-23-2013
CpcF-I subfamily Xen7305DRAFT_00020290 ZP_21056139.1 Xenococcus sp. PCC7305 PC+PEI 206 04-23-2013
CpcF-I subfamily GLO73106DRAFT_00012730 ZP_21051609.1 Gloeocapsa sp. PCC73106 PC+PEI 219 04-23-2013
CpcF-I subfamily Chro_3412 YP_007092740.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 212 04-23-2013
CpcF-I subfamily Cal6303_3400 YP_007138307.1 Calothrix sp. PCC6303 PC+PEI 2 241 04-29-2013
CpcF-I subfamily Cha6605_3627 YP_007098137.1 Chamaesiphon minutus PCC6605 PC+PEI 269 04-29-2013
CpcF-I subfamily Lep6406DRAFT_00020740 ZP_21046667.1 Leptolyngbya sp. PCC6406 PC+PEC 237 04-29-2013
CpcF-I subfamily Cal7507_3704 YP_007066929.1 Calothrix sp. PCC7507 PC+PEC 200 04-29-2013
CpcF-I subfamily Oscil6304_1240 YP_007084875.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 217 04-29-2013
CpcF-I subfamily Nos7107_3140 YP_007050880.1 Nostoc sp. PCC7107 PC+PEC 199 04-29-2013
CpcF-I subfamily LepboDRAFT_3197 Leptolyngbya boryana PCC6306 PC 271 06-11-2013
CpcF-I subfamily Fis9431DRAFT_3457 Fischerella sp. PCC9431 PC+PEC 212 06-12-2013
CpcF-I subfamily FIS9605DRAFT_06543 Fischerella sp. PCC9605 PC+PEC 207 06-12-2013
CpcF-I subfamily FisPCC73103_3438 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 212 06-12-2013
CpcF-I subfamily Scytonema_PCC7110_joined_1635 Scytonema hofmanni PCC7110 PC+PEC 206 06-12-2013
CpcF-I subfamily Osc10802DRAFT_3758 Oscillatoria sp. PCC10802 PC+PEI N-term shortened (17 aa) 218 07-02-2013
CpcF-I subfamily PCC9339DRAFT_01807 Fischerella sp. PCC9339 PC+PEC 212 06-12-2013
CpcF-I subfamily Ana7108_1539 Anabaena sp. PCC7108 PC+PEC 198 06-12-2013
CpcF-I subfamily Chloroglopsis_PCC9212_joined_2969 Chlorogloeopsis sp. PCC9212 PC+PEC 201 06-12-2013
CpcF-I subfamily UYC_06434 Chlorogloeopsis fritschii PCC6912 PC+PEC 201 06-12-2013
CpcF-I subfamily FisPCC7414_3830 Fischerella muscicola PCC7414 PC+PEC 207 06-12-2013
CpcF-I subfamily Fischerella_sp._PCC7521_722 Fischerella thermalis PCC7521 PC+PEC 205 06-12-2013
CpcF-I subfamily Cyan10605_2164 YP_007162294.1 Cyanobacterium aponimum PCC10605 218 06-12-2013
CpcF-I subfamily Syn6312_2504 YP_007062147.1 Synechococcus sp. PCC6312 PC 225 06-12-2013
CpcF-I subfamily Pse7367_3925 YP_007083577.1 Pseudanabaena sp. PCC7367 PC+PEI 256 06-20-2013
CpcF-I subfamily GEI7407_3505 YP_007111024.1 Geitlerinema sp. PCC7407 PC 229 06-20-2013
CpcF-I subfamily PCC7418_1993 YP_007168373.1 Halothece sp. PCC7418 PC 196 06-20-2013
CpcF-I subfamily Dacsa_0415 YP_007142210.1 Crinalium epipsammum PCC9333 PC 206 06-20-2013
CpcF-I subfamily Dacsa_0415 YP_007170561.1 Dactylococcopsis salina PCC8305 206 06-20-2013
CpcF-I subfamily Syn7509DRAFT_00024760 ZP_21041084.1 Synechocystis sp. PCC7509 PC 206 06-20-2013
CpcF-I subfamily Syn7502_03300 YP_007107301.1 Synechococcus sp. PCC7502 PC 210 06-20-2013
CpcF-I subfamily Sta7437_0255 YP_007130838.1 Stanieria cyanosphaera PCC7437 PC+PEI 228 06-20-2013
CpcF-II subfamily SCB01_010100012947 ZP_07974571.1 Synechococcus sp. CB0101 PC 1 220 12-06-2011
CpcF-II subfamily SCB02_010100004420 ZP_07970153.1 Synechococcus sp. CB0205 PC+PEI 2 N-term possibly 5aa too long 228 12-06-2011
CpcF-II subfamily RS9917_02913 ZP_01080765.1 Synechococcus sp. RS9917 PC 1 219 12-06-2011
CpcF-II subfamily WH5701_05885 ZP_01083797.1 Synechococcus sp. WH5701 PC 1 222 12-06-2011
CpcF-II subfamily CPCC7001_1598 ZP_05045410.1 Cyanobium sp. PCC7001 PC 1 223 12-06-2011
CpcF-II subfamily Cyagr_1641 YP_007046133.1 Cyanobium gracile PCC6307 PC 220 04-29-2013
RpcF subfamily sync_0485 YP_729712.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 209 09-26-2011
RpcF subfamily SH8109_0093 ZP_05790743.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b Sequence was incomplete (updated by FP) 210 12-05-2011
RpcF subfamily Syncc9902_1912 YP_377913.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 210 09-26-2011
RpcF subfamily SynWH7803_0476 YP_001224199.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 210 09-26-2011
RpcF subfamily Syn8016DRAFT_2739 ZP_08957392.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 211 11-04-2011
RpcF subfamily SynWH8020_rpcF AAA27349.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 209 08-26-2012
CpeY family sync_0499 YP_729726.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 442 09-26-2011
CpeY family Syncc9605_0429 YP_380760.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 441 09-26-2011
CpeY family SH8109_0080 ZP_05789451.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 441 09-26-2011
CpeY family SYNW2013 NP_898104.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 441 09-26-2011
CpeY family Syncc9902_1898 YP_377899.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 441 09-26-2011
CpeY family BL107_08931 ZP_01469889.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 444 09-26-2011
CpeY family SynWH7803_0491 YP_001224214.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 430 09-26-2011
CpeY family WH7805_06686 ZP_01123337.1 Synechococcus sp. WH7805 PC+PEI 2 427 09-26-2011
CpeY family RS9916_40211 ZP_01473085.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 440 09-26-2011
CpeY family SynRCC307_2053 YP_001228309.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 441 09-26-2011
CpeY family SCB02_010100004298 ZP_07970129.1 Synechococcus sp. CB0205 PC+PEI 2 427 11-04-2011
CpeY family S7335_3216 ZP_05036780.1 Synechococcus sp. PCC7335 PC+PEI CA3 N-term shortened (11 aa removed by FP: MQAAFDRFLTA) 420 09-26-2011
CpeY family Syn8016DRAFT_2753 ZP_08957406.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 438 11-04-2011
CpeY family NATL1_03891 YP_001014218.1 Prochlorococcus marinus NATL1A PEIII high b/a 434 09-26-2011
CpeY family PMN2A_1675 YP_292866.1 Prochlorococcus marinus NATL2A PEIII high b/a 434 09-26-2011
CpeY family Pro0341 NP_874735.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 439 09-26-2011
CpeY family P9211_03361 YP_001550221.1 Prochlorococcus marinus MIT9211 PEIII High b/a 441 09-26-2011
CpeY family P9303_22321 YP_001018232.1 Prochlorococcus sp. MIT9303 PEIII high b/a 449 09-26-2011
CpeY family PMT1679 NP_895506.1 Prochlorococcus sp. MIT9313 PEIII high b/a 449 09-26-2011
CpeY family CwatDRAFT_0665 ZP_00518425.1 Crocosphaera watsonii WH8501 PC+PEI There is another partial CpeY sequence in this genome almost 100% identical to this one (possibly an assembly error). 419 08-27-2012
CpeY family PCC7424_5731 YP_002381026.1 Cyanothece sp. PCC7424 PC+PEI 2 431 09-26-2011
CpeY family PCC8801_4512 YP_002364790.1 Cyanothece sp. PCC8801 PC+PEI 2 425 09-26-2011
CpeY family Cyan7822_4045 YP_003889245.1 Cyanothece sp. PCC7822 PC+PEI 2 431 09-26-2011
CpeY family gi|47606672|gb|AAT36318.1| AAT36318.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 429 09-26-2011
CpeY family gvip158 NP_924134.1 Gloeobacter violaceus PCC7421 PC+PEI 2 428 11-24-2011
CpeY family GL6909_3532 Gloeothece sp. PCC6909/1 PC+PEI 2 431 06-06-2011
CpeY family Npun_R3801 YP_001867128.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 427 09-26-2011
CpeY family Tery_0990 YP_720843.1 Trichodesmium erythraeum IMS101 PC+PEI 425 09-26-2011
CpeY family CwatDRAFT_5980 ZP_00514215.1 Crocosphaera watsonii WH8501 PC+PEI Sequence incomplete. N-term extended (35 aa added) but still incomplete. 282 08-27-2012
CpeY family LYNGBM3L_56120 ZP_08427724.1 Lyngbya majuscula 3L PC+PEI 2 427 10-19-2011
CpeY family CWATWH0003_0669 EHJ14661.1 Crocosphaera watsonii WH0003 PC+PEI 426 02-22-2012
CpeY family MICAI_2830023 ZP_10228735.1 Microcystis sp. T1-4 PC+PEI 2 420 08-22-2012
CpeY family SynWH8020_cpeY AAA27337.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 N-term extended (23 aa added) 442 08-27-2012
CpeY family Ple7327_1467 YP_007080403.1 Pleurocapsa sp. PCC7327 PC+PEI N-terml shortened (16 aa) 427 07-02-2013
CpeY family Mic7113_4748 YP_007123827.1 Microcoleus sp. PCC7113 PC+PEI 2 426 04-23-2013
CpeY family Osc7112_1033 YP_007114007.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 429 04-23-2013
CpeY family GLO73106DRAFT_00012680 ZP_21051604.1 Gloeocapsa sp. PCC73106 PC+PEI 422 04-23-2013
CpeY family Xen7305DRAFT_00050160 ZP_21053197.1 Xenococcus sp. PCC7305 PC+PEI 422 04-23-2013
CpeY family Pse7367_3888 YP_007083545.1 Pseudanabaena sp. PCC7367 PC+PEI 442 04-23-2013
CpeY family Lepto7376_4083 YP_007073046.1 Leptolyngbya sp. PCC7376 PC+PEI 422 04-23-2013
CpeY family Sta7437_4287 YP_007134724.1 Stanieria cyanosphaera PCC7437 PC+PEI 426 04-29-2013
CpeY family Cal6303_1007 YP_007136044.1 Calothrix sp. PCC6303 PC+PEI 2 427 04-29-2013
CpeY family Cha6605_4053 YP_007098536.1 Chamaesiphon minutus PCC6605 PC+PEI N-term shortened (25 aa) 430 07-02-2013
CpeY family Cal6303_4892 YP_007139762.1 Calothrix sp. PCC6303 PC+PEI 2 421 04-29-2013
CpeY family Osc10802DRAFT_5372 Oscillatoria sp. PCC10802 PC+PEI 427 06-12-2013
CpeY family ZP_18907655 ZP_18907655.1 Leptolyngbya sp. PCC7375 PC+PEI 2 427 06-20-2013
CpeZ family sync_0500 YP_729727.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 N-term shortened (15aa removed by FP: LLLSPAKIVKSSSCV) 208 09-26-2011
CpeZ family Syncc9605_0430 YP_380761.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 212 09-26-2011
CpeZ family SH8109_0079 ZP_05789880.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 212 09-26-2011
CpeZ family SYNW2012 NP_898103.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 206 09-26-2011
CpeZ family Syncc9902_1897 YP_377898.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 209 09-26-2011
CpeZ family BL107_08936 ZP_01469890.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 209 09-26-2011
CpeZ family SynWH7803_0488 YP_001224211.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 205 09-26-2011
CpeZ family WH7805_06706 ZP_01123341.1 Synechococcus sp. WH7805 PC+PEI 2 209 09-26-2011
CpeZ family RS9916_40216 ZP_01473086.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 209 09-26-2011
CpeZ family SynRCC307_2052 YP_001228308.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 205 09-26-2011
CpeZ family SCB02_010100004363 ZP_07970142.1 Synechococcus sp. CB0205 PC+PEI 2 204 11-04-2011
CpeZ family S7335_2652 ZP_05036218.1 Synechococcus sp. PCC7335 PC+PEI CA3 209 09-26-2011
CpeZ family Syn8016DRAFT_2750 ZP_08957403.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 204 11-04-2011
CpeZ family NATL1_03871 YP_001014216.1 Prochlorococcus marinus NATL1A PEIII high b/a 198 09-26-2011
CpeZ family PMN2A_1673 YP_292864.1 Prochlorococcus marinus NATL2A PEIII high b/a 198 09-26-2011
CpeZ family Pro0339 NP_874733.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a A block is missing in protomata 202 09-26-2011
CpeZ family P9211_03341 YP_001550219.1 Prochlorococcus marinus MIT9211 PEIII High b/a A block is missing in protomata 200 09-26-2011
CpeZ family P9303_22361 YP_001018236.1 Prochlorococcus sp. MIT9303 PEIII high b/a 210 09-26-2011
CpeZ family PMT1681 NP_895508.1 Prochlorococcus sp. MIT9313 PEIII high b/a 211 09-26-2011
CpeZ family CwatDRAFT_5981 ZP_00514214.1 Crocosphaera watsonii WH8501 PC+PEI 204 09-26-2011
CpeZ family PCC7424_5730 YP_002381025.1 Cyanothece sp. PCC7424 PC+PEI 2 201 09-26-2011
CpeZ family PCC8801_4513 YP_002364791.1 Cyanothece sp. PCC8801 PC+PEI 2 208 09-26-2011
CpeZ family Cyan7822_4046 YP_003889246.1 Cyanothece sp. PCC7822 PC+PEI 2 201 09-26-2011
CpeZ family gi|47606673|gb|AAT36319.1| AAT36319.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 205 09-26-2011
CpeZ family gvip157 NP_924133.1 Gloeobacter violaceus PCC7421 PC+PEI 2 204 11-24-2011
CpeZ family GL6909_3531 Gloeothece sp. PCC6909/1 PC+PEI 2 204 06-06-2011
CpeZ family Npun_R3805 YP_001867132.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 202 09-26-2011
CpeZ family Tery_0995 YP_720846.1 Trichodesmium erythraeum IMS101 PC+PEI lower blastp hit on >Tery_0980 203 09-26-2011
CpeZ family Tery_0980 YP_720834.1 Trichodesmium erythraeum IMS101 PC+PEI Blastp hit on cpeZ (but lower than >Tery_0995) 219 09-26-2011
CpeZ family LYNGBM3L_56070 ZP_08427728.1 Lyngbya majuscula 3L PC+PEI 2 220 10-19-2011
CpeZ family CAJ73184.1| CAJ73184.1 Guillardia theta CCMP2712 Cr-PE 545 n.a. Low protoscan score 229 10-28-2011
CpeZ family CwatDRAFT_0406 ZP_00518848.1 Crocosphaera watsonii WH8501 PC+PEI Low score, similar to Tery_0980 (IMS101) 219 12-02-2011
CpeZ family CWATWH0003_0668 EHJ14660.1 Crocosphaera watsonii WH0003 PC+PEI 204 02-22-2012
CpeZ family CWATWH0003_5315a1 EHJ09924.1 Crocosphaera watsonii WH0003 PC+PEI Incomplete, 2nd copy? 186 02-22-2012
CpeZ family MICAI_2660036 ZP_10228479.1 Microcystis sp. T1-4 PC+PEI 2 203 08-22-2012
CpeZ family SynWH8020_cpeZ AAA27336.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 N-term extended (22 aa added) 208 08-27-2012
CpeZ family Mic7113_4747 YP_007123826.1 Microcoleus sp. PCC7113 PC+PEI 2 204 04-23-2013
CpeZ family Ple7327_1946 YP_007080845.1 Pleurocapsa sp. PCC7327 PC+PEI 202 04-23-2013
CpeZ family Osc7112_1034 YP_007114008.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 204 04-23-2013
CpeZ family GLO73106DRAFT_00012690 ZP_21051605.1 Gloeocapsa sp. PCC73106 PC+PEI 204 04-23-2013
CpeZ family Pse7367_3889 YP_007083546.1 Pseudanabaena sp. PCC7367 PC+PEI 206 04-23-2013
CpeZ family Lepto7376_1198 YP_007070389.1 Leptolyngbya sp. PCC7376 PC+PEI 202 04-23-2013
CpeZ family Xen7305DRAFT_00032340 ZP_21054999.1 Xenococcus sp. PCC7305 PC+PEI 209 04-23-2013
CpeZ family Sta7437_3350 YP_007133822.1 Stanieria cyanosphaera PCC7437 PC+PEI 202 04-29-2013
CpeZ family Cha6605_4052 YP_007098535.1 Chamaesiphon minutus PCC6605 PC+PEI 204 04-29-2013
CpeZ family Cal6303_1006 YP_007136043.1 Calothrix sp. PCC6303 PC+PEI 2 202 04-29-2013
CpeZ family Osc10802DRAFT_5371 Oscillatoria sp. PCC10802 PC+PEI This sequence has a long N-term which has similarity to C-term end of CpeC (possible sequencing/assembly error) 281 07-02-2013
CpeZ family ZP_18907654 ZP_18907654.1 Leptolyngbya sp. PCC7375 PC+PEI 2 205 06-20-2013
PecE family alr0526 NP_484570.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 253 09-26-2011
PecE family Ava_2928 YP_323434.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 253 09-27-2011
PecE family Aazo_0294 YP_003720002.1 Anabaena (Nostoc) azollae 0708 PC+PEC 261 09-26-2011
PecE family FJSC11DRAFT_0798 ZP_08984592.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 257 11-04-2011
PecE family MC7420_3694 ZP_05028438.1 Microcoleus chthonoplastes PCC7420 PC+PEC 260 09-26-2011
PecE family Nos7524_4171 YP_007077534.1 Nostoc sp. PCC7524 PC+PEC 258 04-23-2013
PecE family Cylst_0749 YP_007145756.1 Cylindrospermum stagnale PCC7417 PC+PEC 257 04-23-2013
PecE family Anacy_2030 YP_007156420.1 Anabaena cylindrica PCC7122 PC+PEC 260 04-23-2013
PecE family Chro_3404 YP_007092732.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 254 04-23-2013
PecE family Nos7107_3148 YP_007050888.1 Nostoc sp. PCC7107 PC+PEC 256 04-29-2013
PecE family Cal7507_3697 YP_007066922.1 Calothrix sp. PCC7507 PC+PEC 257 04-29-2013
PecE family Lep6406DRAFT_00020410 ZP_21046698.1 Leptolyngbya sp. PCC6406 PC+PEC 260 04-29-2013
PecE family Fis9431DRAFT_3464 Fischerella sp. PCC9431 PC+PEC 256 06-12-2013
PecE family FIS9605DRAFT_06536 Fischerella sp. PCC9605 PC+PEC 257 06-12-2013
PecE family FisPCC73103_3447 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 256 06-12-2013
PecE family Scytonema_PCC7110_joined_1626 Scytonema hofmanni PCC7110 PC+PEC 258 06-12-2013
PecE family PCC9339DRAFT_01814 Fischerella sp. PCC9339 PC+PEC 256 06-12-2013
PecE family Ana7108_3406 Anabaena sp. PCC7108 PC+PEC 260 06-12-2013
PecE family Chloroglopsis_PCC9212_joined_2978 Chlorogloeopsis sp. PCC9212 PC+PEC 273 06-12-2013
PecE family UYC_06443 Chlorogloeopsis fritschii PCC6912 PC+PEC 273 06-12-2013
PecE family FisPCC7414_3837 Fischerella muscicola PCC7414 PC+PEC N-term shortened (35 aa) 257 07-02-2013
PecE family Fischerella_sp._PCC7521_715 Fischerella thermalis PCC7521 PC+PEC 257 06-12-2013
PecE family Riv7116_3567 Rivularia sp. PCC7116 PC+PEC Wrongly marked as pseudo gene in refseq 256 06-20-2013
PecF family alr0527 NP_484571.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 173 09-26-2011
PecF family Ava_2929 YP_323435.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 213 09-27-2011
PecF family Aazo_0293 YP_003720001.1 Anabaena (Nostoc) azollae 0708 PC+PEC Sequence with an N-term shorter than others (seemingly lacks about 22 otherwise conserved aa) but no obvious problem in genome sequence. The missing N-term contains 3 or 4 His in other strains. 151 08-28-2012
PecF family FJSC11DRAFT_0797 ZP_08984591.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 209 11-04-2011
PecF family MC7420_3606 ZP_05028350.1 Microcoleus chthonoplastes PCC7420 PC+PEC 202 09-26-2011
PecF family Cylst_0750 YP_007145757.1 Cylindrospermum stagnale PCC7417 PC+PEC 215 04-23-2013
PecF family Anacy_2029 YP_007156419.1 Anabaena cylindrica PCC7122 PC+PEC 172 04-23-2013
PecF family Nos7524_4172 YP_007077535.1 Nostoc sp. PCC7524 PC+PEC 199 04-23-2013
PecF family Chro_3405 YP_007092733.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 208 04-23-2013
PecF family Riv7116_3566 YP_007056565.1 Rivularia sp. PCC7116 PC+PEC 174 04-23-2013
PecF family Nos7107_3147 YP_007050887.1 Nostoc sp. PCC7107 PC+PEC 208 04-29-2013
PecF family Cal7507_3698 YP_007066923.1 Calothrix sp. PCC7507 PC+PEC 212 04-29-2013
PecF family Lep6406DRAFT_00020400 ZP_21046697.1 Leptolyngbya sp. PCC6406 PC+PEC 202 04-29-2013
PecF family Fis9431DRAFT_3463 Fischerella sp. PCC9431 PC+PEC 210 06-12-2013
PecF family FIS9605DRAFT_06537 Fischerella sp. PCC9605 PC+PEC 210 06-12-2013
PecF family FisPCC73103_3446 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 210 06-12-2013
PecF family Scytonema_PCC7110_joined_1627 Scytonema hofmanni PCC7110 PC+PEC 170 06-12-2013
PecF family PCC9339DRAFT_01813 Fischerella sp. PCC9339 PC+PEC 210 06-12-2013
PecF family Ana7108_3405 Anabaena sp. PCC7108 PC+PEC 151 06-12-2013
PecF family Chloroglopsis_PCC9212_joined_2976 Chlorogloeopsis sp. PCC9212 PC+PEC 209 06-12-2013
PecF family UYC_06441 Chlorogloeopsis fritschii PCC6912 PC+PEC 209 06-12-2013
PecF family FisPCC7414_3836 Fischerella muscicola PCC7414 PC+PEC 209 06-12-2013
PecF family Fischerella_sp._PCC7521_716 Fischerella thermalis PCC7521 PC+PEC 209 06-12-2013
RpcG family Syncc9605_0418 YP_380749.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 492 09-26-2011
RpcG family SYNW2025 NP_898116.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 466 09-26-2011
RpcG family BL107_08866 ZP_01469876.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 459 09-26-2011
RpcG family RS9916_40131 ZP_01473069.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 467 09-26-2011
RpcG family CwatDRAFT_0661 ZP_00518422.1 Crocosphaera watsonii WH8501 PC+PEI Although this genome also contains rpcE/F genes, WH8501 has been shown that alpha-PC attaches a PUB (Swanson et al. 1991). So the role of rpcE/F genes is unclear. 473 08-30-2012
CpeF family sync_0497 YP_729724.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 301 10-25-2011
CpeF family Syncc9902_1901 YP_377902.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 293 10-25-2011
CpeF family BL107_08916 ZP_01469886.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 308 10-25-2011
CpeF family SynWH7803_0489 YP_001224212.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 298 10-25-2011
CpeF family WH7805_06701 ZP_01123340.1 Synechococcus sp. WH7805 PC+PEI 2 298 10-25-2011
CpeF family RS9916_40196 ZP_01473082.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 297 10-25-2011
CpeF family SynRCC307_2056 YP_001228312.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 304 10-25-2011
CpeF family SCB02_010100004358 ZP_07970141.1 Synechococcus sp. CB0205 PC+PEI 2 MLFPLLV not present in genbank 305 11-04-2011
CpeF family S7335_3548 ZP_05037110.1 Synechococcus sp. PCC7335 PC+PEI CA3 296 10-25-2011
CpeF family Syn8016DRAFT_2751 ZP_08957404.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 308 11-04-2011
CpeF family NATL1_03881 YP_001014217.1 Prochlorococcus marinus NATL1A PEIII high b/a 287 10-26-2011
CpeF family PMN2A_1674 YP_292865.1 Prochlorococcus marinus NATL2A PEIII high b/a 287 10-26-2011
CpeF family Pro0340 NP_874734.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 298 10-26-2011
CpeF family P9211_03351 YP_001550220.1 Prochlorococcus marinus MIT9211 PEIII High b/a 285 10-26-2011
CpeF family P9303_22351 YP_001018235.1 Prochlorococcus sp. MIT9303 PEIII high b/a 315 10-26-2011
CpeF family PMT1680 NP_895507.1 Prochlorococcus sp. MIT9313 PEIII high b/a 306 10-26-2011
CpeF family CwatDRAFT_0409 ZP_00518851.1 Crocosphaera watsonii WH8501 PC+PEI 288 10-25-2011
CpeF family PCC7424_5719 YP_002381014.1 Cyanothece sp. PCC7424 PC+PEI 2 299 10-25-2011
CpeF family PCC8801_4511 YP_002364789.1 Cyanothece sp. PCC8801 PC+PEI 2 286 10-25-2011
CpeF family Cyan7822_4029 YP_003889229.1 Cyanothece sp. PCC7822 PC+PEI 2 294 10-25-2011
CpeF family gi|9622258|gb|AAF89697.1| AAF89697.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 303 10-25-2011
CpeF family gll1255 NP_924201.1 Gloeobacter violaceus PCC7421 PC+PEI 2 290 10-25-2011
CpeF family GL6909_3552 Gloeothece sp. PCC6909/1 PC+PEI 2 300 10-25-2011
CpeF family Npun_F3804 YP_001867131.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 300 10-25-2011
CpeF family Tery_0978 YP_720832.1 Trichodesmium erythraeum IMS101 PC+PEI N-term shortened (24 aa removed) 310 08-30-2012
CpeF family Tery_0987 YP_720840.1 Trichodesmium erythraeum IMS101 PC+PEI Best BlastP hit on CpeF (but lower than Tery_0978) 285 08-30-2012
CpeF family LYNGBM3L_55090 ZP_08427735.1 Lyngbya majuscula 3L PC+PEI 2 289 10-28-2011
CpeF family S7335_4282 ZP_05037842.1 Synechococcus sp. PCC7335 PC+PEI CA3 Low blast and protomatch score. 332 01-02-2012
CpeF family CWATWH0003_5310t4 EHJ09925.1 Crocosphaera watsonii WH0003 PC+PEI incomplete n-term (start of contig) 262 02-22-2012
CpeF family MICAI_2830021 ZP_10228733.1 Microcystis sp. T1-4 PC+PEI 2 309 08-22-2012
CpeF family SynW8020_mpeV AAA27339.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 301 08-26-2012
CpeF family Ple7327_1461 YP_007080401.1 Pleurocapsa sp. PCC7327 PC+PEI 304 04-24-2013
CpeF family Mic7113_4746 YP_007123825.1 Microcoleus sp. PCC7113 PC+PEI 2 303 04-24-2013
CpeF family Osc7112_1017 YP_007113991.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 293 04-24-2013
CpeF family Pse7367_3917 YP_007083570.1 Pseudanabaena sp. PCC7367 PC+PEI 311 04-24-2013
CpeF family GLO73106DRAFT_00012620 ZP_21051598.1 Gloeocapsa sp. PCC73106 PC+PEI 284 04-24-2013
CpeF family ZP_18907651 ZP_18907651.1 Leptolyngbya sp. PCC7375 PC+PEI 2 303 04-24-2013
CpeF family Lepto7376_4080 YP_007073044.1 Leptolyngbya sp. PCC7376 PC+PEI 300 04-24-2013
CpeF family Xen7305DRAFT_00032330 ZP_21054998.1 Xenococcus sp. PCC7305 PC+PEI 300 04-24-2013
CpeF family Cal6303_1005 YP_007136042.1 Calothrix sp. PCC6303 PC+PEI 2 302 04-29-2013
CpeF family Sta7437_3852 YP_007134302.1 Stanieria cyanosphaera PCC7437 PC+PEI 295 04-29-2013
CpeF family Cha6605_4057 YP_007098540.1 Chamaesiphon minutus PCC6605 PC+PEI 305 04-29-2013
CpeF family Cal6303_4952 YP_007139821.1 Calothrix sp. PCC6303 PC+PEI 2 299 04-29-2013
MpeU family sync_0501 YP_729728.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 291 10-25-2011
MpeU family Syncc9605_0432 YP_380763.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 299 10-25-2011
MpeU family SH8109_0074 ZP_05788568.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 298 10-25-2011
MpeU family SYNW2011 NP_898102.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 301 10-25-2011
MpeU family Syncc9902_1896 YP_377897.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 298 10-25-2011
MpeU family BL107_08941 ZP_01469891.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 298 10-25-2011
MpeU family RS9916_40221 ZP_01473087.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 298 10-25-2011
MpeU family SynRCC307_2051 YP_001228307.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 298 10-25-2011
MpeU family SynWH8020_mpeU AAA27335.1 Synechococcus sp. WH8020 PC+PEI+PEII 3d/CA4 297 08-26-2012
MpeW family SH8109_0077 ZP_05790143.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 396 08-28-2012
MpeY family sync_0506 YP_729733.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 398 09-26-2011
MpeY family Syncc9605_0436 YP_380767.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 398 09-26-2011
MpeY family SH8109_0069 ZP_05788234.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 398 11-06-2011
MpeY family SYNW2007 NP_898098.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 398 09-26-2011
MpeY family Syncc9902_1892 YP_377893.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 398 09-26-2011
MpeY family BL107_08961 ZP_01469895.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 400 09-26-2011
MpeY family SynWH7803_0494 YP_001224217.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 397 09-26-2011
MpeY family RS9916_40241 ZP_01473091.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 398 09-26-2011
MpeY family SynRCC307_2047 YP_001228303.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 398 09-26-2011
MpeY family Syn8016DRAFT_2756 ZP_08957409.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 402 11-04-2011
MpeZ family sync_2228 YP_731426.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 409 09-26-2011
MpeZ family Syncc9902_1568 YP_377570.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 409 09-26-2011
MpeZ family BL107_10891 ZP_01469555.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 409 09-26-2011
MpeZ family RS9916_39531 ZP_01472949.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 413 09-26-2011
MpeZ family SynRCC307_2004 YP_001228260.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 414 09-26-2011
IaiH family sync_2351 YP_731548.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 269 10-26-2011
IaiH family Syncc9605_2060 YP_382355.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 270 10-26-2011
IaiH family SH8109_1105 ZP_05789908.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 270 10-26-2011
IaiH family SYNW0621 NP_896714.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 269 10-26-2011
IaiH family Syncc9902_0612 YP_376624.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 270 10-26-2011
IaiH family BL107_16005 ZP_01468434.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 270 10-26-2011
IaiH family SynWH7803_2056 YP_001225779.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 269 10-26-2011
IaiH family WH7805_12348 ZP_01122851.1 Synechococcus sp. WH7805 PC+PEI 2 269 10-26-2011
IaiH family RS9917_08150 ZP_01081220.1 Synechococcus sp. RS9917 PC 1 268 10-26-2011
IaiH family RS9916_34787 ZP_01470988.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 269 10-26-2011
IaiH family WH5701_15416 ZP_01084128.1 Synechococcus sp. WH5701 PC 1 274 10-26-2011
IaiH family SynRCC307_1951 YP_001228207.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 258 10-26-2011
IaiH family SCB01_010100011409 ZP_07974267.1 Synechococcus sp. CB0101 PC 1 266 11-04-2011
IaiH family SCB02_010100005388 ZP_07970337.1 Synechococcus sp. CB0205 PC+PEI 2 MAASPYESPKGSSDLDFDSEL not present in refseq 266 11-04-2011
IaiH family S7335_4906 ZP_05038464.1 Synechococcus sp. PCC7335 PC+PEI CA3 255 10-26-2011
IaiH family SYNPCC7002_A1412 YP_001734659.1 Synechococcus sp. PCC7002 PC 1 246 10-26-2011
IaiH family CPCC7001_263 ZP_05044076.1 Cyanobium sp. PCC7001 PC 1 277 10-26-2011
IaiH family Syn8016DRAFT_2224 ZP_08956879.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 269 11-04-2011
IaiH family PMM1480 NP_893597.1 Prochlorococcus marinus MED4 (CCMP1986/CCMP1378) beta-PEIII low b/a 256 10-26-2011
IaiH family P9515_16601 YP_001011974.1 Prochlorococcus marinus MIT9515 beta-PEIII low b/a 256 10-26-2011
IaiH family P9301_16701 YP_001091894.1 Prochlorococcus marinus MIT9301 beta-PEIII low b/a 255 10-26-2011
IaiH family A9601_16821 YP_001010072.1 Prochlorococcus marinus AS9601 beta-PEIII low b/a 255 10-26-2011
IaiH family P9215_17481 YP_001484947.1 Prochlorococcus marinus MIT9215 beta-PEIII low b/a 255 10-26-2011
IaiH family PMT9312_1573 YP_398069.1 Prochlorococcus marinus MIT9312 beta-PEIII low b/a 255 10-26-2011
IaiH family P9202_32 ZP_05137436.1 Prochlorococcus marinus MIT9202 beta-PEIII low b/a 255 10-26-2011
IaiH family NATL1_18791 YP_001015699.1 Prochlorococcus marinus NATL1A PEIII high b/a 269 10-26-2011
IaiH family PMN2A_1010 YP_292203.1 Prochlorococcus marinus NATL2A PEIII high b/a 269 10-26-2011
IaiH family Pro1634 NP_876025.1 Prochlorococcus marinus SS120 (CCMP1375) PEIII high b/a 269 10-26-2011
IaiH family P9211_16001 YP_001551485.1 Prochlorococcus marinus MIT9211 PEIII High b/a 269 10-26-2011
IaiH family PUH18301_1815 Prochlorococcus marinus UH18301 beta-PEIII low b/a 255 10-26-2011
IaiH family P9303_04441 YP_001016461.1 Prochlorococcus sp. MIT9303 PEIII high b/a 263 10-26-2011
IaiH family PMT1501 NP_895328.1 Prochlorococcus sp. MIT9313 PEIII high b/a 263 10-26-2011
IaiH family slr1098 NP_440077.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 252 10-26-2011
IaiH family AM1_2319 YP_001516644.1 Acaryochloris marina MBIC11017 (AM1) PC 1 252 10-26-2011
IaiH family alr4537 NP_488577.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 252 10-26-2011
IaiH family Ava_1404 YP_321922.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 252 10-26-2011
IaiH family Aazo_0466 YP_003720123.1 Anabaena (Nostoc) azollae 0708 PC+PEC 254 10-26-2011
IaiH family AmaxDRAFT_1788 ZP_03272970.1 Arthrospira (Spirulina) maxima CS-328 PC 1 261 10-26-2011
IaiH family CwatDRAFT_4428 ZP_00515633.1 Crocosphaera watsonii WH8501 PC+PEI 250 10-26-2011
IaiH family cce_0658 YP_001802075.1 Cyanothece sp. ATCC51142 PC 1 250 10-26-2011
IaiH family PCC7424_2038 YP_002377336.1 Cyanothece sp. PCC7424 PC+PEI 2 246 10-26-2011
IaiH family Cyan7425_0542 YP_002481294.1 Cyanothece sp. PCC7425 PC 1 250 10-26-2011
IaiH family PCC8801_3723 YP_002373834.1 Cyanothece sp. PCC8801 PC+PEI 2 249 10-26-2011
IaiH family Cyan8802_3776 YP_003139418.1 Cyanothece sp. PCC8802 PC 1 249 10-26-2011
IaiH family CY0110_28669 ZP_01730141.1 Cyanothece sp. CCY0110 PC 1 250 10-26-2011
IaiH family Cyan7822_5445 YP_003890596.1 Cyanothece sp. PCC7822 PC+PEI 2 243 10-26-2011
IaiH family FJSC11DRAFT_1220 ZP_08985014.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 252 11-04-2011
IaiH family gll3007 NP_925953.1 Gloeobacter violaceus PCC7421 PC+PEI 2 240 10-26-2011
IaiH family GL6909_0099 Gloeothece sp. PCC6909/1 PC+PEI 2 247 10-26-2011
IaiH family L8106_07506 ZP_01622090.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 N-term extended by FP (New start: complement(37527); stretch added: MEDEKLSVIHSPEAWESPLDH) 247 09-26-2011
IaiH family MC7420_1911 ZP_05025197.1 Microcoleus chthonoplastes PCC7420 PC+PEC 252 10-26-2011
IaiH family MAE_48080 YP_001659822.1 Microcystis aeruginosa NIES-843 PC 1 247 10-26-2011
IaiH family N9414_19727 ZP_01629226.1 Nodularia spumigena CCY9414 PC 1 252 10-26-2011
IaiH family Npun_F4500 YP_001867809.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 252 10-26-2011
IaiH family Synpcc7942_1752 YP_400769.1 Synechococcus elongatus PCC7942 PC 1 250 10-26-2011
IaiH family syc2339_d YP_173049.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 250 10-26-2011
IaiH family CYB_2106 YP_478315.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 242 10-26-2011
IaiH family CYA_0113 YP_473606.1 Synechococcus sp. JA-3-3Ab PC 1 239 10-26-2011
IaiH family tll0329 NP_681119.1 Thermosynechococcus elongatus BP-1 PC 1 251 10-26-2011
IaiH family Tery_4484 YP_723943.1 Trichodesmium erythraeum IMS101 PC+PEI 246 10-26-2011
IaiH family PCC_0182 YP_002048842.1 Paulinella chromatophora M0880 PC 1 267 11-02-2011
IaiH family CRD_00800 ZP_06303837.1 Raphidiopsis brookii D9 PC 1 252 11-02-2011
IaiH family CRC_00053 ZP_06306749.1 Cylindrospermopsis raciborskii CS-505 PC 1 252 11-02-2011
IaiH family IPF_5485 CAO87094.1 Microcystis aeruginosa PCC7806 PC 1 247 11-02-2011
IaiH family NIES39_Q01300 BAI94138.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 261 11-02-2011
IaiH family MicvaDRAFT_2477 ZP_08493978.1 Microcoleus vaginatus FGP-2 PC 1 248 11-02-2011
IaiH family LYNGBM3L_64630 ZP_08431563.1 Lyngbya majuscula 3L PC+PEI 2 252 11-02-2011
IaiH family OSCI_940010 ZP_07109377.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 248 11-02-2011
IaiH family Cy51472DRAFT_2922 ZP_08974126.1 Cyanothece sp. ATCC51472 PC 1 250 01-10-2012
IaiH family AplaP_010100011636 ZP_06382319.1 Arthrospira (Spirulina) platensis Paraca PC 1 261 01-24-2012
IaiH family ACCM5_010100001232 ZP_09245880.1 Acaryochloris sp. CCMEE5410 APC only 252 01-24-2012
IaiH family CWATWH0003_2056 EHJ13243.1 Crocosphaera watsonii WH0003 PC+PEI 250 02-22-2012
IaiH family MICAI_2780007 ZP_10228668.1 Microcystis sp. T1-4 PC+PEI 2 247 08-22-2012
IaiH family MICAG_660025 CCI29018.1 Microcystis aeruginosa PCC9808 PC 1 247 08-22-2012
IaiH family MICAB_2830008 CCH96991.1 Microcystis aeruginosa PCC9717 PC 1 247 08-23-2012
IaiH family MICAK_320003 CCI37314.1 Microcystis aeruginosa PCC9701 PC 1 247 08-23-2012
IaiH family MICAC_5470010 CCI04185.1 Microcystis aeruginosa PCC9443 PC 1 247 08-23-2012
IaiH family MICAD_2620024 CCI07607.1 Microcystis aeruginosa PCC7941 PC 1 247 08-23-2012
IaiH family Osc7112_4012 YP_007116762.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 248 04-24-2013
IaiH family Ple7327_4580 YP_007083233.1 Pleurocapsa sp. PCC7327 PC+PEI 252 04-24-2013
IaiH family Chro_4094 YP_007093367.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 252 04-24-2013
IaiH family Mic7113_3327 YP_007122465.1 Microcoleus sp. PCC7113 PC+PEI 2 252 04-24-2013
IaiH family Lepto7376_3254 YP_007072316.1 Leptolyngbya sp. PCC7376 PC+PEI 246 04-24-2013
IaiH family Glo7428_1948 YP_007127656.1 Gloeocapsa sp. PCC7428 PC 253 04-24-2013
IaiH family Anacy_4866 YP_007159119.1 Anabaena cylindrica PCC7122 PC+PEC 252 04-24-2013
IaiH family Nos7524_2481 YP_007075918.1 Nostoc sp. PCC7524 PC+PEC 252 04-24-2013
IaiH family Xen7305DRAFT_00003450 ZP_21057788.1 Xenococcus sp. PCC7305 PC+PEI 254 04-24-2013
IaiH family Syn7509DRAFT_00026090 ZP_21040934.1 Synechocystis sp. PCC7509 PC 252 04-24-2013
IaiH family ZP_20932525 ZP_20932525.1 Microcystis aeruginosa TAIHU98 PC 1 247 04-24-2013
IaiH family Dacsa_2567 YP_007172513.1 Dactylococcopsis salina PCC8305 253 04-24-2013
IaiH family Cyast_1343 YP_007164957.1 Cyanobacterium stanieri PCC7202 PC 247 04-24-2013
IaiH family Cylst_1364 YP_007146333.1 Cylindrospermum stagnale PCC7417 PC+PEC 252 04-24-2013
IaiH family Riv7116_2387 YP_007055450.1 Rivularia sp. PCC7116 PC+PEC 252 04-24-2013
IaiH family GLO73106DRAFT_00021120 ZP_21050727.1 Gloeocapsa sp. PCC73106 PC+PEI 251 04-24-2013
IaiH family PCC7418_1206 YP_007167622.1 Halothece sp. PCC7418 PC 264 04-24-2013
IaiH family Pse7429DRAFT_0263 ZP_21064643.1 Pseudanabaena sp. (biceps) PCC7429 PC 253 04-24-2013
IaiH family Pse7367_0988 YP_007101715.1 Pseudanabaena sp. PCC7367 PC+PEI 248 04-24-2013
IaiH family ZP_18908495 ZP_18908495.1 Leptolyngbya sp. PCC7375 PC+PEI 2 251 04-24-2013
IaiH family Oscil6304_5734 YP_007089129.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 247 04-29-2013
IaiH family Cri9333_0885 YP_007141311.1 Crinalium epipsammum PCC9333 PC 252 04-29-2013
IaiH family GEI7407_1580 YP_007109123.1 Geitlerinema sp. PCC7407 PC 250 04-29-2013
IaiH family MICCA_1930013 ZP_18816492.1 Microcystis aeruginosa PCC9432 PC 1 247 04-29-2013
IaiH family Sta7437_0351 YP_007130929.1 Stanieria cyanosphaera PCC7437 PC+PEI 252 04-29-2013
IaiH family Cal6303_5536 YP_007140388.1 Calothrix sp. PCC6303 PC+PEI 2 252 04-29-2013
IaiH family Cyagr_3038 YP_007047461.1 Cyanobium gracile PCC6307 PC 266 04-29-2013
IaiH family Syn6312_3460 YP_007063030.1 Synechococcus sp. PCC6312 PC 249 04-29-2013
IaiH family Cal7507_4545 YP_007067746.1 Calothrix sp. PCC7507 PC+PEC 252 04-29-2013
IaiH family Nos7107_5208 YP_007052867.1 Nostoc sp. PCC7107 PC+PEC 252 04-29-2013
IaiH family Cha6605_0246 YP_007095075.1 Chamaesiphon minutus PCC6605 PC+PEI 257 04-29-2013
IaiH family Cyan10605_1845 YP_007161991.1 Cyanobacterium aponimum PCC10605 248 04-29-2013
IaiH family Lep6406DRAFT_00001360 ZP_21048597.1 Leptolyngbya sp. PCC6406 PC+PEC 260 04-29-2013
IaiH family Syn7502_01130 YP_007105374.1 Synechococcus sp. PCC7502 PC 263 04-29-2013
IaiH family LepboDRAFT_3635 Leptolyngbya boryana PCC6306 PC 251 06-11-2013
IaiH family Fis9431DRAFT_3532 Fischerella sp. PCC9431 PC+PEC 252 06-12-2013
IaiH family FIS9605DRAFT_00906 Fischerella sp. PCC9605 PC+PEC 252 06-12-2013
IaiH family FisPCC73103_2012 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 252 06-12-2013
IaiH family Scytonema_PCC7110_joined_9529 Scytonema hofmanni PCC7110 PC+PEC 253 06-12-2013
IaiH family Osc10802DRAFT_4729 Oscillatoria sp. PCC10802 PC+PEI 248 06-12-2013
IaiH family PCC9339DRAFT_01656 Fischerella sp. PCC9339 PC+PEC 252 06-12-2013
IaiH family Ana7108_4503 Anabaena sp. PCC7108 PC+PEC 252 06-12-2013
IaiH family Chloroglopsis_PCC9212_joined_4547 Chlorogloeopsis sp. PCC9212 PC+PEC 252 06-12-2013
IaiH family UYC_01049 Chlorogloeopsis fritschii PCC6912 PC+PEC 252 06-12-2013
IaiH family FisPCC7414_6969 Fischerella muscicola PCC7414 PC+PEC 252 06-12-2013
IaiH family Fischerella_sp._PCC7521_3782 Fischerella thermalis PCC7521 PC+PEC 252 06-12-2013
L8106_11777 homologs family L8106_11777 ZP_01621519.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 316 09-26-2011
L8106_11777 homologs family NIES39_O04890 BAI93736.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 314 12-01-2011
L8106_11777 homologs family AmaxDRAFT_5407 ZP_03276581.1 Arthrospira (Spirulina) maxima CS-328 PC 1 292 12-01-2011
L8106_11777 homologs family AplaP_010100002137 ZP_06380464.1 Arthrospira (Spirulina) platensis Paraca PC 1 Incomplete n-term (end of contig). Almost identical to homologs in other Arthrospira species. 179 08-27-2012
L8106_16949 homologs family L8106_16949 ZP_01620421.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 419 09-26-2011
L8106_16949 homologs family MicvaDRAFT_3571 ZP_08493473.1 Microcoleus vaginatus FGP-2 PC 1 430 12-05-2011
L8106_16949 homologs family OSCI_1070009 ZP_07109619.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 452 12-05-2011
L8106_16949 homologs family N9414_05274 ZP_01629849.1 Nodularia spumigena CCY9414 PC 1 437 12-05-2011
L8106_16949 homologs family Npun_F1530 YP_001865162.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 432 06-12-2013
L8106_16949 homologs family Tery_0072 YP_720054.1 Trichodesmium erythraeum IMS101 PC+PEI 442 12-05-2011
L8106_16949 homologs family all0605 NP_484649.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 398 12-05-2011
L8106_16949 homologs family Ava_4537 YP_325030.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 400 12-05-2011
L8106_16949 homologs family Cyan8802_3638 YP_003139288.1 Cyanothece sp. PCC8802 PC 1 395 12-05-2011
L8106_16949 homologs family PCC8801_2470 YP_002372635.1 Cyanothece sp. PCC8801 PC+PEI 2 395 12-05-2011
L8106_16949 homologs family FJSC11DRAFT_0884 ZP_08984678.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 404 12-05-2011
L8106_16949 homologs family CwatDRAFT_4661 ZP_00515205.1 Crocosphaera watsonii WH8501 PC+PEI 377 12-05-2011
L8106_16949 homologs family Cyan7822_3567 YP_003888783.1 Cyanothece sp. PCC7822 PC+PEI 2 391 12-05-2011
L8106_16949 homologs family NIES39_H00170 BAI90942.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 410 12-05-2011
L8106_16949 homologs family PCC7424_1681 YP_002376985.1 Cyanothece sp. PCC7424 PC+PEI 2 388 12-05-2011
L8106_16949 homologs family LYNGBM3L_62310 ZP_08431195.1 Lyngbya majuscula 3L PC+PEI 2 397 12-05-2011
L8106_16949 homologs family MC7420_2776 ZP_05030778.1 Microcoleus chthonoplastes PCC7420 PC+PEC 398 12-05-2011
L8106_16949 homologs family CY0110_30523 ZP_01730379.1 Cyanothece sp. CCY0110 PC 1 381 12-05-2011
L8106_16949 homologs family AmaxDRAFT_3716 ZP_03274892.1 Arthrospira (Spirulina) maxima CS-328 PC 1 414 12-05-2011
L8106_16949 homologs family cce_2919 YP_001804333.1 Cyanothece sp. ATCC51142 PC 1 377 12-05-2011
L8106_16949 homologs family MAE_60750 YP_001661089.1 Microcystis aeruginosa NIES-843 PC 1 396 12-05-2011
L8106_16949 homologs family IPF_2545 CAO87418.1 Microcystis aeruginosa PCC7806 PC 1 396 12-05-2011
L8106_16949 homologs family AM1_2983 YP_001517295.1 Acaryochloris marina MBIC11017 (AM1) PC 1 395 12-05-2011
L8106_16949 homologs family SYNPCC7002_A1619 YP_001734865.1 Synechococcus sp. PCC7002 PC 1 393 12-05-2011
L8106_16949 homologs family S7335_5516 ZP_05039071.1 Synechococcus sp. PCC7335 PC+PEI CA3 439 12-05-2011
L8106_16949 homologs family GL6909_2003 Gloeothece sp. PCC6909/1 PC+PEI 2 366 12-05-2011
L8106_16949 homologs family Cy51472DRAFT_4412 ZP_08975615.1 Cyanothece sp. ATCC51472 PC 1 377 01-10-2012
L8106_16949 homologs family AplaP_010100015438 ZP_06383071.1 Arthrospira (Spirulina) platensis Paraca PC 1 410 01-24-2012
L8106_16949 homologs family ACCM5_010100005086 ZP_09246638.1 Acaryochloris sp. CCMEE5410 APC only 395 01-24-2012
L8106_16949 homologs family CWATWH0003_1645 EHJ13671.1 Crocosphaera watsonii WH0003 PC+PEI 377 02-22-2012
L8106_16949 homologs family MICAI_840009 ZP_10230413.1 Microcystis sp. T1-4 PC+PEI 2 396 08-22-2012
L8106_16949 homologs family MICAG_840013 CCI29493.1 Microcystis aeruginosa PCC9808 PC 1 396 08-22-2012
L8106_16949 homologs family MICAB_5340001 CCH98773.1 Microcystis aeruginosa PCC9717 PC 1 396 08-23-2012
L8106_16949 homologs family MICAK_1050005 CCI34771.1 Microcystis aeruginosa PCC9701 PC 1 396 08-23-2012
L8106_16949 homologs family MICAC_4580012 CCI03406.1 Microcystis aeruginosa PCC9443 PC 1 396 08-23-2012
L8106_16949 homologs family MICAD_840005 CCI09780.1 Microcystis aeruginosa PCC7941 PC 1 396 08-23-2012
L8106_16949 homologs family Nos7524_4345 YP_007077701.1 Nostoc sp. PCC7524 PC+PEC 395 04-24-2013
L8106_16949 homologs family Syn7509DRAFT_00026430 ZP_21040968.1 Synechocystis sp. PCC7509 PC 429 04-24-2013
L8106_16949 homologs family ZP_20933301 ZP_20933301.1 Microcystis aeruginosa TAIHU98 PC 1 396 04-24-2013
L8106_16949 homologs family Ple7327_1571 YP_007080500.1 Pleurocapsa sp. PCC7327 PC+PEI 417 04-24-2013
L8106_16949 homologs family Osc7112_1244 YP_007114204.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 438 04-24-2013
L8106_16949 homologs family Riv7116_0550 YP_007053692.1 Rivularia sp. PCC7116 PC+PEC 401 04-24-2013
L8106_16949 homologs family Chro_3567 YP_007092891.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 464 04-24-2013
L8106_16949 homologs family Mic7113_0135 YP_007119479.1 Microcoleus sp. PCC7113 PC+PEI 2 434 04-24-2013
L8106_16949 homologs family Glo7428_1959 YP_007127666.1 Gloeocapsa sp. PCC7428 PC 435 04-24-2013
L8106_16949 homologs family Lepto7376_4351 YP_007073293.1 Leptolyngbya sp. PCC7376 PC+PEI 389 04-24-2013
L8106_16949 homologs family Pse7367_2344 YP_007103033.1 Pseudanabaena sp. PCC7367 PC+PEI 423 04-24-2013
L8106_16949 homologs family Xen7305DRAFT_00042220 ZP_21054004.1 Xenococcus sp. PCC7305 PC+PEI 412 04-24-2013
L8106_16949 homologs family MICCA_3420010 ZP_18818233.1 Microcystis aeruginosa PCC9432 PC 1 396 04-29-2013
L8106_16949 homologs family Cal7507_2105 YP_007065381.1 Calothrix sp. PCC7507 PC+PEC 433 04-29-2013
L8106_16949 homologs family Nos7107_2254 YP_007050016.1 Nostoc sp. PCC7107 PC+PEC 396 04-29-2013
L8106_16949 homologs family Oscil6304_0495 YP_007084161.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 482 04-29-2013
L8106_16949 homologs family Cri9333_2973 YP_007143322.1 Crinalium epipsammum PCC9333 PC 429 04-29-2013
L8106_16949 homologs family Cha6605_0750 YP_007095548.1 Chamaesiphon minutus PCC6605 PC+PEI 451 04-29-2013
L8106_16949 homologs family LepboDRAFT_3472 Leptolyngbya boryana PCC6306 PC 425 06-11-2013
L8106_16949 homologs family Fis9431DRAFT_4372 Fischerella sp. PCC9431 PC+PEC 364 06-12-2013
L8106_16949 homologs family FIS9605DRAFT_00990 Fischerella sp. PCC9605 PC+PEC 417 06-12-2013
L8106_16949 homologs family FisPCC73103_4572 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 364 06-12-2013
L8106_16949 homologs family Scytonema_PCC7110_joined_8104 Scytonema hofmanni PCC7110 PC+PEC 429 06-12-2013
L8106_16949 homologs family Osc10802DRAFT_0992 Oscillatoria sp. PCC10802 PC+PEI 437 06-12-2013
L8106_16949 homologs family PCC9339DRAFT_01500 Fischerella sp. PCC9339 PC+PEC 364 06-12-2013
L8106_16949 homologs family Chloroglopsis_PCC9212_joined_5948 Chlorogloeopsis sp. PCC9212 PC+PEC 432 06-12-2013
L8106_16949 homologs family UYC_03057 Chlorogloeopsis fritschii PCC6912 PC+PEC 432 06-12-2013
L8106_16949 homologs family FisPCC7414_5095 Fischerella muscicola PCC7414 PC+PEC 404 06-12-2013
L8106_16949 homologs family Fischerella_sp._PCC7521_613 Fischerella thermalis PCC7521 PC+PEC 404 06-12-2013
L8106_22089 homologs family L8106_22089 ZP_01623387.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 314 09-26-2011
L8106_22089 homologs family NIES39_A07090 BAI88547.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 360 12-06-2011
L8106_22089 homologs family AmaxDRAFT_0777 ZP_03271959.1 Arthrospira (Spirulina) maxima CS-328 PC 1 334 12-06-2011
L8106_22089 homologs family Tery_5007 YP_724393.1 Trichodesmium erythraeum IMS101 PC+PEI 398 12-06-2011
L8106_22089 homologs family MC7420_2176 ZP_05026788.1 Microcoleus chthonoplastes PCC7420 PC+PEC 417 12-06-2011
L8106_22089 homologs family OSCI_2990020 ZP_07111171.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 429 12-06-2011
L8106_22089 homologs family MicvaDRAFT_5105 ZP_08494867.1 Microcoleus vaginatus FGP-2 PC 1 397 12-06-2011
L8106_22089 homologs family LYNGBM3L_34780 ZP_08427350.1 Lyngbya majuscula 3L PC+PEI 2 422 12-06-2011
L8106_22089 homologs family Npun_R4663 YP_001867963.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 380 12-06-2011
L8106_22089 homologs family N9414_18048 ZP_01631680.1 Nodularia spumigena CCY9414 PC 1 394 12-06-2011
L8106_22089 homologs family all3549+all3550 NP_487589.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC frameshift (or sequencing error) in all3550 389 01-10-2012
L8106_22089 homologs family Ava_3528 YP_324030.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 389 12-06-2011
L8106_22089 homologs family Cyan8802_0724 YP_003136498.1 Cyanothece sp. PCC8802 PC 1 392 12-06-2011
L8106_22089 homologs family PCC8801_0696 YP_002370937.1 Cyanothece sp. PCC8801 PC+PEI 2 392 12-06-2011
L8106_22089 homologs family FJSC11DRAFT_4556 ZP_08988348.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 333 12-06-2011
L8106_22089 homologs family cce_2926 YP_001804340.1 Cyanothece sp. ATCC51142 PC 1 391 12-06-2011
L8106_22089 homologs family Cyan7822_4402 YP_003889591.1 Cyanothece sp. PCC7822 PC+PEI 2 388 12-06-2011
L8106_22089 homologs family CY0110_02889 ZP_01727378.1 Cyanothece sp. CCY0110 PC 1 394 12-06-2011
L8106_22089 homologs family Aazo_5152 YP_003723334.1 Anabaena (Nostoc) azollae 0708 PC+PEC 358 12-06-2011
L8106_22089 homologs family MAE_36470 YP_001658661.1 Microcystis aeruginosa NIES-843 PC 1 N-term shortened (18 aa removed) 364 08-28-2012
L8106_22089 homologs family IPF_5551 CAO86824.1 Microcystis aeruginosa PCC7806 PC 1 Incomplete sequence. Another chunk is in IPF_6118 (CAO87604.1) 325 01-10-2012
L8106_22089 homologs family CwatDRAFT_0171 ZP_00519405.1 Crocosphaera watsonii WH8501 PC+PEI split between 3 different contigs: ZP_00517336.1 (CwatDRAFT_2581), ZP_00513741.1 (CwatDRAFT_6637) and ZP_00519405.1 (CwatDRAFT_0171) 107 08-29-2012
L8106_22089 homologs family GL6909_1567 Gloeothece sp. PCC6909/1 PC+PEI 2 373 12-06-2011
L8106_22089 homologs family Cy51472DRAFT_4419 ZP_08975622.1 Cyanothece sp. ATCC51472 PC 1 391 01-10-2012
L8106_22089 homologs family AplaP_010100006555 ZP_06381327.1 Arthrospira (Spirulina) platensis Paraca PC 1 332 01-24-2012
L8106_22089 homologs family MICAI_2510011 ZP_10228186.1 Microcystis sp. T1-4 PC+PEI 2 364 08-22-2012
L8106_22089 homologs family MICAG_1620006 CCI22083.1 Microcystis aeruginosa PCC9808 PC 1 367 08-22-2012
L8106_22089 homologs family MICAB_4560020 CCH98232.1 Microcystis aeruginosa PCC9717 PC 1 364 08-23-2012
L8106_22089 homologs family MICAK_1200005 CCI34961.1 Microcystis aeruginosa PCC9701 PC 1 367 08-23-2012
L8106_22089 homologs family MICAC_1420008 CCI00959.1 Microcystis aeruginosa PCC9443 PC 1 366 08-23-2012
L8106_22089 homologs family MICAD_1710014 CCI06343.1 Microcystis aeruginosa PCC7941 PC 1 367 08-23-2012
L8106_22089 homologs family Ple7327_1958 YP_007080856.1 Pleurocapsa sp. PCC7327 PC+PEI 366 04-24-2013
L8106_22089 homologs family Nos7524_5290 YP_007078610.1 Nostoc sp. PCC7524 PC+PEC 394 04-24-2013
L8106_22089 homologs family Cylst_6105 YP_007150756.1 Cylindrospermum stagnale PCC7417 PC+PEC 391 04-24-2013
L8106_22089 homologs family ZP_20934303 ZP_20934303.1 Microcystis aeruginosa TAIHU98 PC 1 367 04-24-2013
L8106_22089 homologs family IPF_6118 CAO87604.1 Microcystis aeruginosa PCC7806 PC 1 Shorter than other L8106_22089 homologs 251 04-24-2013
L8106_22089 homologs family Riv7116_5847 YP_007058758.1 Rivularia sp. PCC7116 PC+PEC 369 04-24-2013
L8106_22089 homologs family Osc7112_4556 YP_007117267.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 397 04-24-2013
L8106_22089 homologs family Anacy_5157 YP_007159401.1 Anabaena cylindrica PCC7122 PC+PEC 385 04-24-2013
L8106_22089 homologs family Nos7107_0871 YP_007048687.1 Nostoc sp. PCC7107 PC+PEC 399 04-29-2013
L8106_22089 homologs family MICCA_2560018 ZP_18817326.1 Microcystis aeruginosa PCC9432 PC 1 367 04-29-2013
L8106_22089 homologs family Cal6303_4175 YP_007139061.1 Calothrix sp. PCC6303 PC+PEI 2 394 04-29-2013
L8106_22089 homologs family GEI7407_1102 YP_007108651.1 Geitlerinema sp. PCC7407 PC 451 04-29-2013
L8106_22089 homologs family Cal7507_4899 YP_007068086.1 Calothrix sp. PCC7507 PC+PEC 371 04-29-2013
L8106_22089 homologs family LepboDRAFT_2621 Leptolyngbya boryana PCC6306 PC 322 06-11-2013
L8106_22089 homologs family Fis9431DRAFT_1567 Fischerella sp. PCC9431 PC+PEC 333 06-12-2013
L8106_22089 homologs family FIS9605DRAFT_01162 Fischerella sp. PCC9605 PC+PEC 378 06-12-2013
L8106_22089 homologs family FisPCC73103_2341 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 297 06-12-2013
L8106_22089 homologs family Scytonema_PCC7110_joined_4761 Scytonema hofmanni PCC7110 PC+PEC 389 06-12-2013
L8106_22089 homologs family Osc10802DRAFT_2033 Oscillatoria sp. PCC10802 PC+PEI 376 06-12-2013
L8106_22089 homologs family PCC9339DRAFT_04646 Fischerella sp. PCC9339 PC+PEC 335 06-12-2013
L8106_22089 homologs family Ana7108_3306 Anabaena sp. PCC7108 PC+PEC 388 06-12-2013
L8106_22089 homologs family Chloroglopsis_PCC9212_joined_1928 Chlorogloeopsis sp. PCC9212 PC+PEC 381 06-12-2013
L8106_22089 homologs family UYC_02940 Chlorogloeopsis fritschii PCC6912 PC+PEC 381 06-12-2013
L8106_22089 homologs family FisPCC7414_5280 Fischerella muscicola PCC7414 PC+PEC 334 06-12-2013
L8106_22089 homologs family Fischerella_sp._PCC7521_2408 Fischerella thermalis PCC7521 PC+PEC 281 06-12-2013
MC7420_3535 homologs family MC7420_3535 ZP_05029509.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1322 12-05-2011
MC7420_3535 homologs family IPF_2632 CAO90937.1 Microcystis aeruginosa PCC7806 PC 1 1500 12-05-2011
MC7420_3535 homologs family Tery_1841 YP_721570.1 Trichodesmium erythraeum IMS101 PC+PEI 1343 12-05-2011
MC7420_3535 homologs family LYNGBM3L_29440 ZP_08428664.1 Lyngbya majuscula 3L PC+PEI 2 1405 12-05-2011
MC7420_3535 homologs family alr1903 NP_485943.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 1547 12-05-2011
MC7420_3535 homologs family N9414_03573 ZP_01630825.1 Nodularia spumigena CCY9414 PC 1 1285 12-05-2011
MC7420_3535 homologs family ZP_08491193.1 ZP_08491193.1 Microcoleus vaginatus FGP-2 PC 1 1179 12-05-2011
MC7420_3535 homologs family Cyan7822_4279 YP_003889472.1 Cyanothece sp. PCC7822 PC+PEI 2 1244 12-05-2011
MC7420_3535 homologs family MAE_07890 YP_001655803.1 Microcystis aeruginosa NIES-843 PC 1 890 12-06-2011
MC7420_3535 homologs family LYNGBM3L_30460 ZP_08428879.1 Lyngbya majuscula 3L PC+PEI 2 1365 12-06-2011
MC7420_3535 homologs family MC7420_6333 ZP_05026152.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1184 12-06-2011
MC7420_3535 homologs family PCC7424_1133 YP_002376452.1 Cyanothece sp. PCC7424 PC+PEI 2 951 12-06-2011
MC7420_3535 homologs family OSCI_180019 ZP_07108594.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 1008 12-06-2011
MC7420_3535 homologs family Ava_3508 YP_324010.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 1148 12-06-2011
MC7420_3535 homologs family MC7420_6677 ZP_05028167.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1432 12-06-2011
MC7420_3535 homologs family MC7420_6046 ZP_05027237.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1260 12-06-2011
MC7420_3535 homologs family all3465 NP_487505.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 1119 12-06-2011
MC7420_3535 homologs family NIES39_J02930 BAI91340.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 1219 01-10-2012
MC7420_3535 homologs family Tery_0826 YP_720713.1 Trichodesmium erythraeum IMS101 PC+PEI 1328 12-06-2011
MC7420_3535 homologs family MC7420_4498 ZP_05028866.1 Microcoleus chthonoplastes PCC7420 PC+PEC 923 12-06-2011
MC7420_3535 homologs family LYNGBM3L_55810 ZP_08427827.1 Lyngbya majuscula 3L PC+PEI 2 1106 12-06-2011
MC7420_3535 homologs family LYNGBM3L_00970 ZP_08427981.1 Lyngbya majuscula 3L PC+PEI 2 1139 12-06-2011
MC7420_3535 homologs family LYNGBM3L_75690 ZP_08427936.1 Lyngbya majuscula 3L PC+PEI 2 1108 12-06-2011
MC7420_3535 homologs family N9414_06844 ZP_01628936.1 Nodularia spumigena CCY9414 PC 1 936 12-06-2011
MC7420_3535 homologs family MicvaDRAFT_0024 ZP_08495704.1 Microcoleus vaginatus FGP-2 PC 1 981 12-06-2011
MC7420_3535 homologs family all3892 NP_487932.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 874 12-06-2011
MC7420_3535 homologs family AmaxDRAFT_1081 ZP_03272263.1 Arthrospira (Spirulina) maxima CS-328 PC 1 1093 12-06-2011
MC7420_3535 homologs family NIES39_K01090 BAI91758.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 892 12-06-2011
MC7420_3535 homologs family OSCI_440025 ZP_07108865.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 992 12-07-2011
MC7420_3535 homologs family alr2986 NP_487026.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 885 12-07-2011
MC7420_3535 homologs family IPF_2635 CAO90934.1 Microcystis aeruginosa PCC7806 PC 1 Much shorter than other MC7420_3535 homologs 263 12-07-2011
MC7420_3535 homologs family L8106_24365 ZP_01619849.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 1044 12-07-2011
MC7420_3535 homologs family PCC7424_1763 YP_002377065.1 Cyanothece sp. PCC7424 PC+PEI 2 1475 12-07-2011
MC7420_3535 homologs family MC7420_2915 ZP_05024179.1 Microcoleus chthonoplastes PCC7420 PC+PEC 1355 12-07-2011
MC7420_3535 homologs family LYNGBM3L_40770 ZP_08429450.1 Lyngbya majuscula 3L PC+PEI 2 1273 12-07-2011
MC7420_3535 homologs family AmaxDRAFT_0188 ZP_03271372.1 Arthrospira (Spirulina) maxima CS-328 PC 1 786 12-07-2011
MC7420_3535 homologs family PCC8801_0753 YP_002370992.1 Cyanothece sp. PCC8801 PC+PEI 2 838 12-07-2011
MC7420_4701 homologs family MC7420_4701 ZP_05025511.1 Microcoleus chthonoplastes PCC7420 PC+PEC 455 11-30-2011
MC7420_4701 homologs family Cyan7822_1857 YP_003887117.1 Cyanothece sp. PCC7822 PC+PEI 2 457 11-30-2011
MC7420_4701 homologs family MicvaDRAFT_1724 ZP_08491624.1 Microcoleus vaginatus FGP-2 PC 1 Sequence shortened at N-term (104 aa removed: MNSAATLIQQLPELSDAQFHQKYLKQKQGMRTLATILPQVEQQSLALRAVKLALKVNLKLGSKLAGTVKPEFQIATIKLIEKIPTSPLLKIQLLALTSSDMAIP) 534 09-11-2012
MC7420_4701 homologs family MC7420_1061 ZP_05028540.1 Microcoleus chthonoplastes PCC7420 PC+PEC This sequence has a much shorter N-term than others. But not a frameshift. 173 09-11-2012
MC7420_4701 homologs family Osc7112_2212 YP_007115088.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 638 04-24-2013
MC7420_4701 homologs family Osc10802DRAFT_3523 Oscillatoria sp. PCC10802 PC+PEI 550 06-12-2013
CotB family S7335_4506 ZP_05038065.1 Synechococcus sp. PCC7335 PC+PEI CA3 220 09-26-2011
CotB family CwatDRAFT_1185 ZP_00517831.1 Crocosphaera watsonii WH8501 PC+PEI 218 09-26-2011
CotB family PCC7424_5727 YP_002381022.1 Cyanothece sp. PCC7424 PC+PEI 2 218 09-26-2011
CotB family PCC7424_1391 YP_002376703.1 Cyanothece sp. PCC7424 PC+PEI 2 219 09-26-2011
CotB family Cyan7425_3035 YP_002483730.1 Cyanothece sp. PCC7425 PC 1 222 09-26-2011
CotB family Cyan7822_0127 YP_003885453.1 Cyanothece sp. PCC7822 PC+PEI 2 219 09-26-2011
CotB family Cyan7822_4037 YP_003889237.1 Cyanothece sp. PCC7822 PC+PEI 2 220 09-26-2011
CotB family gi|33090216|gb|AAP93903.1| AAP93903.1 Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) Fd33 (UTEX481/PCC7601) PC+PEI CA3 219 09-26-2011
CotB family gvip178 NP_924203.1 Gloeobacter violaceus PCC7421 PC+PEI 2 217 11-24-2011
CotB family GL6909_0631 Gloeothece sp. PCC6909/1 PC+PEI 2 219 08-30-2011
CotB family Npun_R0734 YP_001864429.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 220 09-26-2011
CotB family Tery_2382 YP_722075.1 Trichodesmium erythraeum IMS101 PC+PEI N-term shortened (15 aa removed: MLVYVKKGKQNSQII) 219 09-26-2011
CotB family LYNGBM3L_16600 ZP_08428239.1 Lyngbya majuscula 3L PC+PEI 2 218 10-28-2011
CotB family MicvaDRAFT_0237 ZP_08495395.1 Microcoleus vaginatus FGP-2 PC 1 218 10-28-2011
CotB family GL6909_3542 Gloeothece sp. PCC6909/1 PC+PEI 2 218 11-24-2011
CotB family CWATWH0003_4320 EHJ10938.1 Crocosphaera watsonii WH0003 PC+PEI 218 02-22-2012
CotB family Ple7327_3416 YP_007082181.1 Pleurocapsa sp. PCC7327 PC+PEI 218 04-24-2013
CotB family Mic7113_4739 YP_007123818.1 Microcoleus sp. PCC7113 PC+PEI 2 227 04-24-2013
CotB family Xen7305DRAFT_00028590 ZP_21055352.1 Xenococcus sp. PCC7305 PC+PEI 218 04-24-2013
CotB family Osc7112_1071 YP_007114038.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 218 04-24-2013
CotB family Osc7112_1024 YP_007113998.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 218 04-24-2013
CotB family Sta7437_3034 YP_007133518.1 Stanieria cyanosphaera PCC7437 PC+PEI 218 04-29-2013
CotB family Cal6303_3397 YP_007138304.1 Calothrix sp. PCC6303 PC+PEI 2 219 04-29-2013
CotB family Osc10802DRAFT_2573 Oscillatoria sp. PCC10802 PC+PEI 218 06-12-2013
CotB homologs 1 family sync_0128 YP_729365.1 Synechococcus sp. CC9311 PC+PEI+PEII 3d/CA4 208 09-26-2011
CotB homologs 1 family Syncc9605_0122 YP_380453.1 Synechococcus sp. CC9605 PC+PEI+PEII 3c 204 09-26-2011
CotB homologs 1 family SH8109_0378 ZP_05790768.1 Synechococcus sp. WH8109 PC+PEI+PEII 3b 204 09-26-2011
CotB homologs 1 family SYNW0139 NP_896234.1 Synechococcus sp. WH8102 PC+PEI+PEII 3c 205 09-26-2011
CotB homologs 1 family Syncc9902_0166 YP_376184.1 Synechococcus sp. CC9902 PC+PEI+PEII 3d/CA4 203 09-26-2011
CotB homologs 1 family BL107_05959 ZP_01468938.1 Synechococcus sp. BL107 PC+PEI+PEII 3d/CA4 203 09-26-2011
CotB homologs 1 family SynWH7803_0189 YP_001223912.1 Synechococcus sp. WH7803 PC+PEI+PEII 3a 208 09-26-2011
CotB homologs 1 family WH7805_08566 ZP_01123713.1 Synechococcus sp. WH7805 PC+PEI 2 208 09-26-2011
CotB homologs 1 family RS9917_05100 ZP_01079060.1 Synechococcus sp. RS9917 PC 1 211 09-26-2011
CotB homologs 1 family RS9916_38227 ZP_01471676.1 Synechococcus sp. RS9916 PC+PEI+PEII 3d/CA4 207 09-26-2011
CotB homologs 1 family WH5701_01640 ZP_01084821.1 Synechococcus sp. WH5701 PC 1 210 09-26-2011
CotB homologs 1 family SynRCC307_0128 YP_001226384.1 Synechococcus sp. RCC307 PC+PEI+PEII 3b 177 12-05-2011
CotB homologs 1 family SCB01_010100014119 ZP_07974801.1 Synechococcus sp. CB0101 PC 1 196 11-04-2011
CotB homologs 1 family SCB02_010100002826 ZP_07969839.1 Synechococcus sp. CB0205 PC+PEI 2 193 05-24-2012
CotB homologs 1 family CPCC7001_2625 ZP_05046435.1 Cyanobium sp. PCC7001 PC 1 215 09-26-2011
CotB homologs 1 family Syn8016DRAFT_1730 ZP_08956385.1 Synechococcus sp. WH8016 PC+PEI+PEII 3a 208 11-04-2011
CotB homologs 1 family Cyan7425_3615 YP_002484296.1 Cyanothece sp. PCC7425 PC 1 221 09-26-2011
CotB homologs 1 family Synpcc7942_2325 YP_401342.1 Synechococcus elongatus PCC7942 PC 1 N-term shortened (30 aa removed : MASAIAKLSAAPASVTPCGSVKDERLSCAS) 225 08-28-2012
CotB homologs 1 family syc1777_d YP_172487.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 225 09-26-2011
CotB homologs 1 family Cyagr_2203 YP_007046657.1 Cyanobium gracile PCC6307 PC 199 04-29-2013
CotB homologs 2 family SYNPCC7002_A1440 YP_001734687.1 Synechococcus sp. PCC7002 PC 1 222 09-26-2011
CotB homologs 2 family slr1687 NP_441698.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 223 09-26-2011
CotB homologs 2 family alr0616 NP_484660.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC 226 09-26-2011
CotB homologs 2 family Ava_4548 YP_325041.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC 226 09-27-2011
CotB homologs 2 family AmaxDRAFT_5534 ZP_03276708.1 Arthrospira (Spirulina) maxima CS-328 PC 1 6 aa missing on N-term (start scaffold) 217 09-26-2011
CotB homologs 2 family cce_3774 YP_001805188.1 Cyanothece sp. ATCC51142 PC 1 223 09-26-2011
CotB homologs 2 family PCC7424_0572 YP_002375902.1 Cyanothece sp. PCC7424 PC+PEI 2 223 09-26-2011
CotB homologs 2 family PCC8801_1381 YP_002371597.1 Cyanothece sp. PCC8801 PC+PEI 2 220 09-26-2011
CotB homologs 2 family Cyan8802_1415 YP_003137167.1 Cyanothece sp. PCC8802 PC 1 220 09-26-2011
CotB homologs 2 family FJSC11DRAFT_1072 ZP_08984866.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 226 11-04-2011
CotB homologs 2 family gvip128 NP_923927.1 Gloeobacter violaceus PCC7421 PC+PEI 2 233 11-24-2011
CotB homologs 2 family gvip219 NP_924521.1 Gloeobacter violaceus PCC7421 PC+PEI 2 234 11-24-2011
CotB homologs 2 family L8106_28841 ZP_01621447.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 226 09-26-2011
CotB homologs 2 family MC7420_7088 ZP_05023236.1 Microcoleus chthonoplastes PCC7420 PC+PEC 226 09-26-2011
CotB homologs 2 family MAE_56800 YP_001660694.1 Microcystis aeruginosa NIES-843 PC 1 222 09-26-2011
CotB homologs 2 family N9414_02366 ZP_01632466.1 Nodularia spumigena CCY9414 PC 1 226 09-26-2011
CotB homologs 2 family Npun_R1155 YP_001864824.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 226 09-26-2011
CotB homologs 2 family CYB_1190 YP_477428.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 244 09-26-2011
CotB homologs 2 family CYA_0047 YP_473542.1 Synechococcus sp. JA-3-3Ab PC 1 240 09-13-2012
CotB homologs 2 family tll0835 NP_681625.1 Thermosynechococcus elongatus BP-1 PC 1 230 09-26-2011
CotB homologs 2 family Tery_4762 YP_724189.1 Trichodesmium erythraeum IMS101 PC+PEI 223 09-26-2011
CotB homologs 2 family AM1_0043 YP_001514445.1 Acaryochloris marina MBIC11017 (AM1) PC 1 221 09-26-2011
CotB homologs 2 family OSCI_2700008 ZP_07110882.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 225 10-19-2011
CotB homologs 2 family CRD_00077 ZP_06303582.1 Raphidiopsis brookii D9 PC 1 232 10-28-2011
CotB homologs 2 family CRC_02169 ZP_06308244.1 Cylindrospermopsis raciborskii CS-505 PC 1 223 10-28-2011
CotB homologs 2 family OSCI_2700008 ZP_07110882.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 225 10-28-2011
CotB homologs 2 family LYNGBM3L_17970 ZP_08426427.1 Lyngbya majuscula 3L PC+PEI 2 223 10-28-2011
CotB homologs 2 family MicvaDRAFT_3625 ZP_08493520.1 Microcoleus vaginatus FGP-2 PC 1 224 10-28-2011
CotB homologs 2 family NIES39_J05080 BAI91554.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 224 10-28-2011
CotB homologs 2 family IPF_3444 CAO90548.1 Microcystis aeruginosa PCC7806 PC 1 222 10-28-2011
CotB homologs 2 family Cyan7822_1692 YP_003886956.1 Cyanothece sp. PCC7822 PC+PEI 2 223 11-24-2011
CotB homologs 2 family CwatDRAFT_4214 ZP_00515817.1 Crocosphaera watsonii WH8501 PC+PEI 223 11-24-2011
CotB homologs 2 family S7335_3847 ZP_05037409.1 Synechococcus sp. PCC7335 PC+PEI CA3 227 11-24-2011
CotB homologs 2 family Cyan7425_1323 YP_002482061.1 Cyanothece sp. PCC7425 PC 1 212 11-24-2011
CotB homologs 2 family syc2370_d YP_173080.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 234 11-24-2011
CotB homologs 2 family Synpcc7942_1721 YP_400738.1 Synechococcus elongatus PCC7942 PC 1 234 11-24-2011
CotB homologs 2 family GL6909_0310 Gloeothece sp. PCC6909/1 PC+PEI 2 221 11-24-2011
CotB homologs 2 family CMS328C Cyanidioschyzon merolae 10D PC 1 on contig c19f0009, found by tblastn 332 02-21-2012
CotB homologs 2 family CMM226C Cyanidioschyzon merolae 10D PC 1 on contig c13f0002, found by tblastn 420 02-21-2012
CotB homologs 2 family Cy51472DRAFT_2076 ZP_08973280.1 Cyanothece sp. ATCC51472 PC 1 223 01-10-2012
CotB homologs 2 family AplaP_010100006817 ZP_06381377.1 Arthrospira (Spirulina) platensis Paraca PC 1 Incomplete - lacks C-term (end of contig) 154 09-13-2012
CotB homologs 2 family ACCM5_010100026572 ZP_09250884.1 Acaryochloris sp. CCMEE5410 APC only 221 01-24-2012
CotB homologs 2 family CWATWH0003_2253 EHJ13064.1 Crocosphaera watsonii WH0003 PC+PEI 213 02-22-2012
CotB homologs 2 family MICAI_560046 ZP_10229858.1 Microcystis sp. T1-4 PC+PEI 2 222 08-22-2012
CotB homologs 2 family MICAG_930009 CCI29658.1 Microcystis aeruginosa PCC9808 PC 1 222 08-22-2012
CotB homologs 2 family MICAB_5520009 CCH98899.1 Microcystis aeruginosa PCC9717 PC 1 222 08-23-2012
CotB homologs 2 family MICAK_3340002 CCI37520.1 Microcystis aeruginosa PCC9701 PC 1 222 08-23-2012
CotB homologs 2 family MICAC_1120010 CCI00724.1 Microcystis aeruginosa PCC9443 PC 1 222 08-23-2012
CotB homologs 2 family MICCA_1100006 ZP_18815796.1 Microcystis aeruginosa PCC9432 PC 1 222 04-22-2013
CotB homologs 2 family MICAD_2540004 CCI07477.1 Microcystis aeruginosa PCC7941 PC 1 222 08-23-2012
CotB homologs 2 family Anacy_0108 YP_007154627.1 Anabaena cylindrica PCC7122 PC+PEC 226 04-24-2013
CotB homologs 2 family Osc7112_1203 YP_007114165.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 224 04-24-2013
CotB homologs 2 family Syn7509DRAFT_00016380 ZP_21042037.1 Synechocystis sp. PCC7509 PC 286 04-24-2013
CotB homologs 2 family Chro_1677 YP_007091065.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 222 04-24-2013
CotB homologs 2 family GLO73106DRAFT_00011310 ZP_21051666.1 Gloeocapsa sp. PCC73106 PC+PEI 218 04-24-2013
CotB homologs 2 family Cylst_0831 YP_007145837.1 Cylindrospermum stagnale PCC7417 PC+PEC 224 04-24-2013
CotB homologs 2 family Glo7428_4423 YP_007130026.1 Gloeocapsa sp. PCC7428 PC 224 04-24-2013
CotB homologs 2 family Cyast_2481 YP_007166073.1 Cyanobacterium stanieri PCC7202 PC 223 04-24-2013
CotB homologs 2 family Riv7116_2427 YP_007055489.1 Rivularia sp. PCC7116 PC+PEC 227 04-24-2013
CotB homologs 2 family Ple7327_2704 YP_007081541.1 Pleurocapsa sp. PCC7327 PC+PEI 226 04-24-2013
CotB homologs 2 family Nos7524_3942 YP_007077312.1 Nostoc sp. PCC7524 PC+PEC 226 04-24-2013
CotB homologs 2 family Mic7113_0797 YP_007120111.1 Microcoleus sp. PCC7113 PC+PEI 2 223 04-24-2013
CotB homologs 2 family ZP_20932003 ZP_20932003.1 Microcystis aeruginosa TAIHU98 PC 1 222 04-24-2013
CotB homologs 2 family ZP_18907631 ZP_18907631.1 Leptolyngbya sp. PCC7375 PC+PEI 2 228 04-24-2013
CotB homologs 2 family Lepto7376_3616 YP_007072630.1 Leptolyngbya sp. PCC7376 PC+PEI 223 04-24-2013
CotB homologs 2 family Xen7305DRAFT_00015010 ZP_21056717.1 Xenococcus sp. PCC7305 PC+PEI 224 04-24-2013
CotB homologs 2 family Pse7367_3483 YP_007104147.1 Pseudanabaena sp. PCC7367 PC+PEI 223 04-24-2013
CotB homologs 2 family Nos7107_3742 YP_007051453.1 Nostoc sp. PCC7107 PC+PEC 226 04-29-2013
CotB homologs 2 family Cri9333_3249 YP_007143591.1 Crinalium epipsammum PCC9333 PC 224 04-29-2013
CotB homologs 2 family Cal7507_3606 YP_007066832.1 Calothrix sp. PCC7507 PC+PEC 228 04-29-2013
CotB homologs 2 family Sta7437_1180 YP_007131717.1 Stanieria cyanosphaera PCC7437 PC+PEI 220 04-29-2013
CotB homologs 2 family Cal6303_1973 YP_007136978.1 Calothrix sp. PCC6303 PC+PEI 2 226 04-29-2013
CotB homologs 2 family Cyan10605_2501 YP_007162626.1 Cyanobacterium aponimum PCC10605 222 04-29-2013
CotB homologs 2 family Syn6312_1448 YP_007061159.1 Synechococcus sp. PCC6312 PC 234 04-29-2013
CotB homologs 2 family GEI7407_1098 YP_007108647.1 Geitlerinema sp. PCC7407 PC 226 04-29-2013
CotB homologs 2 family Cha6605_3987 YP_007098476.1 Chamaesiphon minutus PCC6605 PC+PEI 229 04-29-2013
CotB homologs 2 family Oscil6304_5510 YP_007088914.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 225 04-29-2013
CotB homologs 2 family Lep6406DRAFT_00051850 ZP_21043592.1 Leptolyngbya sp. PCC6406 PC+PEC 223 04-29-2013
CotB homologs 2 family Pse7429DRAFT_2304 ZP_21066416.1 Pseudanabaena sp. (biceps) PCC7429 PC 226 04-29-2013
CotB homologs 2 family Syn7502_02529 YP_007106636.1 Synechococcus sp. PCC7502 PC 229 04-29-2013
CotB homologs 2 family LepboDRAFT_3278 Leptolyngbya boryana PCC6306 PC 234 06-11-2013
CotB homologs 2 family Fis9431DRAFT_3726 Fischerella sp. PCC9431 PC+PEC 226 06-12-2013
CotB homologs 2 family FIS9605DRAFT_06980 Fischerella sp. PCC9605 PC+PEC 224 06-12-2013
CotB homologs 2 family FisPCC73103_3407 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 226 06-12-2013
CotB homologs 2 family Scytonema_PCC7110_joined_11888 Scytonema hofmanni PCC7110 PC+PEC 226 06-12-2013
CotB homologs 2 family Osc10802DRAFT_5467 Oscillatoria sp. PCC10802 PC+PEI 224 06-12-2013
CotB homologs 2 family PCC9339DRAFT_01728 Fischerella sp. PCC9339 PC+PEC 226 06-12-2013
CotB homologs 2 family Ana7108_2981 Anabaena sp. PCC7108 PC+PEC 226 06-12-2013
CotB homologs 2 family Chloroglopsis_PCC9212_joined_7597 Chlorogloeopsis sp. PCC9212 PC+PEC 238 06-12-2013
CotB homologs 2 family UYC_05285 Chlorogloeopsis fritschii PCC6912 PC+PEC 238 06-12-2013
CotB homologs 2 family FisPCC7414_4392 Fischerella muscicola PCC7414 PC+PEC 226 06-12-2013
CotB homologs 2 family Fischerella_sp._PCC7521_3617 Fischerella thermalis PCC7521 PC+PEC 226 06-12-2013
NblB family L8106_00260 ZP_01624763.1 Lyngbya aestuarii CCY9616 (PCC8106/CCY8106) PC 1 223 09-26-2011
NblB family S7335_5595 ZP_05039147.1 Synechococcus sp. PCC7335 PC+PEI CA3 Blastp 223 09-26-2011
NblB family SYNPCC7002_A0348 YP_001733614.1 Synechococcus sp. PCC7002 PC 1 Blastp 218 09-26-2011
NblB family sll1663 NP_440142.1 Synechocystis sp. PCC6803 (ATCC27184) PC 1 Blastp 220 09-26-2011
NblB family alr3814 NP_487854.1 Anabaena (Nostoc) sp. PCC7120 PC+PEC Blastp 220 09-26-2011
NblB family Ava_1888 YP_322405.1 Anabaena variabilis ATCC29413 (PCC7937) PC+PEC Blastp 220 09-27-2011
NblB family Aazo_0577 YP_003720196.1 Anabaena (Nostoc) azollae 0708 PC+PEC Blastp 218 09-26-2011
NblB family AmaxDRAFT_4484 ZP_03275659.1 Arthrospira (Spirulina) maxima CS-328 PC 1 Blastp 220 09-26-2011
NblB family CwatDRAFT_3505 ZP_00516591.1 Crocosphaera watsonii WH8501 PC+PEI Blastp 219 09-26-2011
NblB family cce_3386 YP_001804800.1 Cyanothece sp. ATCC51142 PC 1 N-term shortened (15 aa removed: MRWFLVNILIYPFII) 219 09-13-2012
NblB family PCC7424_2563 YP_002377847.1 Cyanothece sp. PCC7424 PC+PEI 2 Blastp 220 09-26-2011
NblB family Cyan7425_1432 YP_002482166.1 Cyanothece sp. PCC7425 PC 1 Blastp 220 09-26-2011
NblB family PCC8801_0932 YP_002371165.1 Cyanothece sp. PCC8801 PC+PEI 2 Blastp 220 09-26-2011
NblB family Cyan8802_0959 YP_003136728.1 Cyanothece sp. PCC8802 PC 1 Blastp 220 09-26-2011
NblB family CY0110_12007 ZP_01731445.1 Cyanothece sp. CCY0110 PC 1 Blastp 219 09-26-2011
NblB family Cyan7822_3518 YP_003888735.1 Cyanothece sp. PCC7822 PC+PEI 2 Blastp 220 09-26-2011
NblB family gvip306 NP_925180.1 Gloeobacter violaceus PCC7421 PC+PEI 2 Blastp 215 11-24-2011
NblB family MC7420_7663 ZP_05023685.1 Microcoleus chthonoplastes PCC7420 PC+PEC N-term shortened (11 aa removed: MSDYLLLNTLQ) 218 09-13-2012
NblB family MAE_14280 YP_001656442.1 Microcystis aeruginosa NIES-843 PC 1 Blastp 221 09-26-2011
NblB family N9414_09806 ZP_01630150.1 Nodularia spumigena CCY9414 PC 1 Blastp 220 09-26-2011
NblB family Npun_R5793 YP_001869034.1 Nostoc punctiforme ATCC29133 (PCC73102) PC+PEI 2 Blastp 221 09-26-2011
NblB family Synpcc7942_1823 YP_400840.1 Synechococcus elongatus PCC7942 PC 1 219 08-28-2012
NblB family syc2271_d YP_172981.1 Synechococcus elongatus PCC6301 (ATCC 27144) PC 1 Blastp 221 09-26-2011
NblB family CYB_0185 YP_476448.1 Synechococcus sp. JA-2-3B'a(2-13) PC 1 Blastp 227 09-26-2011
NblB family CYA_2789 YP_476154.1 Synechococcus sp. JA-3-3Ab PC 1 Blastp 226 09-26-2011
NblB family tlr0766 NP_681555.1 Thermosynechococcus elongatus BP-1 PC 1 Blastp 226 09-26-2011
NblB family Tery_2239 YP_721941.1 Trichodesmium erythraeum IMS101 PC+PEI Blastp 220 09-26-2011
NblB family CRD_02854 ZP_06306309.1 Raphidiopsis brookii D9 PC 1 226 10-28-2011
NblB family CRC_01060 ZP_06307576.1 Cylindrospermopsis raciborskii CS-505 PC 1 226 10-28-2011
NblB family OSCI_3860033 ZP_07113489.1 Oscillatoria sp. PCC6506 (PCC9029/ATCC29081 /UTEX 1547) PC 1 220 10-28-2011
NblB family LYNGBM3L_66920 ZP_08431562.1 Lyngbya majuscula 3L PC+PEI 2 220 10-28-2011
NblB family MicvaDRAFT_5366 ZP_08492865.1 Microcoleus vaginatus FGP-2 PC 1 224 10-28-2011
NblB family NIES39_D03910 BAI89809.1 Arthrospira (Spirulina) platensis NIES-39 PC 1 220 10-28-2011
NblB family IPF_2775 CAO89282.1 Microcystis aeruginosa PCC7806 PC 1 221 10-28-2011
NblB family FJSC11DRAFT_0382 ZP_08984176.1 Fischerella sp. (Mastigocladus laminosus) JSC-11 PC+PEC 221 11-24-2011
NblB family GL6909_3251 Gloeothece sp. PCC6909/1 PC+PEI 2 Truncated because the original orf was fused with another 220 11-30-2011
NblB family Cy51472DRAFT_2453 ZP_08973657.1 Cyanothece sp. ATCC51472 PC 1 219 01-10-2012
NblB family AplaP_010100017289 ZP_06383430.1 Arthrospira (Spirulina) platensis Paraca PC 1 N-term shortened (18 aa removed: MRVAPDLNRQQLLNCLTK) 220 09-13-2012
NblB family CWATWH0003_3083 EHJ12197.1 Crocosphaera watsonii WH0003 PC+PEI 219 02-22-2012
NblB family MICAI_3110003 ZP_10229074.1 Microcystis sp. T1-4 PC+PEI 2 221 08-22-2012
NblB family MICAG_200023 CCI23270.1 Microcystis aeruginosa PCC9808 PC 1 221 08-22-2012
NblB family MICAB_4960020 CCH98552.1 Microcystis aeruginosa PCC9717 PC 1 221 08-23-2012
NblB family MICAK_580022 CCI38703.1 Microcystis aeruginosa PCC9701 PC 1 221 08-23-2012
NblB family MICAC_3690016 CCI02719.1 Microcystis aeruginosa PCC9443 PC 1 221 08-23-2012
NblB family MICAD_2940015 CCI08016.1 Microcystis aeruginosa PCC7941 PC 1 221 08-23-2012
NblB family Cylst_5091 YP_007149816.1 Cylindrospermum stagnale PCC7417 PC+PEC 220 04-24-2013
NblB family Anacy_2696 YP_007157043.1 Anabaena cylindrica PCC7122 PC+PEC 220 04-24-2013
NblB family Nos7524_4874 YP_007078199.1 Nostoc sp. PCC7524 PC+PEC 220 04-24-2013
NblB family Mic7113_4080 YP_007123190.1 Microcoleus sp. PCC7113 PC+PEI 2 218 04-24-2013
NblB family Osc7112_0710 YP_007113716.1 Oscillatoria nigro-viridis PCC7112 PC+PEI 2 224 04-24-2013
NblB family ZP_20934124 ZP_20934124.1 Microcystis aeruginosa TAIHU98 PC 1 221 04-24-2013
NblB family Syn7509DRAFT_00041170 ZP_21039471.1 Synechocystis sp. PCC7509 PC 220 04-24-2013
NblB family Ple7327_1847 YP_007080751.1 Pleurocapsa sp. PCC7327 PC+PEI 219 04-24-2013
NblB family Lepto7376_0558 YP_007069818.1 Leptolyngbya sp. PCC7376 PC+PEI 218 04-24-2013
NblB family Xen7305DRAFT_00012810 ZP_21056844.1 Xenococcus sp. PCC7305 PC+PEI 219 04-24-2013
NblB family Glo7428_4688 YP_007130281.1 Gloeocapsa sp. PCC7428 PC 223 04-24-2013
NblB family Chro_0989 YP_007090391.1 Chroococcidiopsis thermalis PCC7203 PC+PEC 219 04-24-2013
NblB family Riv7116_0216 YP_007053370.1 Rivularia sp. PCC7116 PC+PEC 218 04-24-2013
NblB family GLO73106DRAFT_00006030 ZP_21052179.1 Gloeocapsa sp. PCC73106 PC+PEI 218 04-24-2013
NblB family PCC7418_1214 YP_007167630.1 Halothece sp. PCC7418 PC 224 04-24-2013
NblB family ZP_18908692 ZP_18908692.1 Leptolyngbya sp. PCC7375 PC+PEI 2 223 04-24-2013
NblB family Cyast_1913 YP_007165517.1 Cyanobacterium stanieri PCC7202 PC 221 04-24-2013
NblB family Dacsa_1202 YP_007171258.1 Dactylococcopsis salina PCC8305 224 04-24-2013
NblB family Cal7507_1540 YP_007064834.1 Calothrix sp. PCC7507 PC+PEC 220 04-29-2013
NblB family Sta7437_3389 YP_007133861.1 Stanieria cyanosphaera PCC7437 PC+PEI 220 04-29-2013
NblB family MICCA_930006 ZP_18815469.1 Microcystis aeruginosa PCC9432 PC 1 221 04-29-2013
NblB family Nos7107_4026 YP_007051729.1 Nostoc sp. PCC7107 PC+PEC 221 04-29-2013
NblB family Cri9333_0875 YP_007141302.1 Crinalium epipsammum PCC9333 PC 221 04-29-2013
NblB family Cal6303_0988 YP_007136025.1 Calothrix sp. PCC6303 PC+PEI 2 218 04-29-2013
NblB family Cyan10605_2137 YP_007162269.1 Cyanobacterium aponimum PCC10605 219 04-29-2013
NblB family Oscil6304_1780 YP_007085378.1 Oscillatoria acuminata PCC6304 (SAG 1449-3) PC 222 04-29-2013
NblB family GEI7407_0128 YP_007107685.1 Geitlerinema sp. PCC7407 PC 220 04-29-2013
NblB family Lep6406DRAFT_00023300 ZP_21046418.1 Leptolyngbya sp. PCC6406 PC+PEC 220 04-29-2013
NblB family Syn6312_0129 YP_007059926.1 Synechococcus sp. PCC6312 PC 222 04-29-2013
NblB family Cha6605_0245 YP_007095074.1 Chamaesiphon minutus PCC6605 PC+PEI 213 04-29-2013
NblB family LepboDRAFT_1028 Leptolyngbya boryana PCC6306 PC 219 06-11-2013
NblB family Fis9431DRAFT_1583 Fischerella sp. PCC9431 PC+PEC 221 06-12-2013
NblB family FIS9605DRAFT_03310 Fischerella sp. PCC9605 PC+PEC 220 06-12-2013
NblB family FisPCC73103_7578 Fischerella muscicola PCC73103 (SAG 1427-1) PC+PEC 221 06-12-2013
NblB family Scytonema_PCC7110_joined_5306 Scytonema hofmanni PCC7110 PC+PEC 226 06-12-2013
NblB family Osc10802DRAFT_5396 Oscillatoria sp. PCC10802 PC+PEI 336 06-12-2013
NblB family PCC9339DRAFT_01092 Fischerella sp. PCC9339 PC+PEC 221 06-12-2013
NblB family Ana7108_1853 Anabaena sp. PCC7108 PC+PEC 218 06-12-2013
NblB family Chloroglopsis_PCC9212_joined_453 Chlorogloeopsis sp. PCC9212 PC+PEC 221 06-12-2013
NblB family UYC_04806 Chlorogloeopsis fritschii PCC6912 PC+PEC 221 06-12-2013
NblB family FisPCC7414_2854 Fischerella muscicola PCC7414 PC+PEC 221 06-12-2013
NblB family Fischerella_sp._PCC7521_5286 Fischerella thermalis PCC7521 PC+PEC 221 06-12-2013
NblB family Syn7502_00033 YP_007104343.1 Synechococcus sp. PCC7502 PC 219 06-20-2013
NblB family Pse7367_2182 YP_007102874.1 Pseudanabaena sp. PCC7367 PC+PEI 241 06-20-2013
NblB family Pse7429DRAFT_0756 ZP_21065042.1 Pseudanabaena sp. (biceps) PCC7429 PC 225 06-20-2013

Model strain Model strains, Marine strains

Biogenouest Station biologique de Roscoff ANR

Copyright © 2005-2012 Biogenouest® - Legal notice - Contact : Contact GenOuest

Hosted by the GenOuest bioinformatics platform