MC7420_4701 homologs family
Description
All members of this family possess several PBS lyase HEAT-like repeat domains and a C-term dual specificity phosphatase, catalytic domain.
Motif
A motif characterising this family is available.
Showing only sure genes
Gene | Locus tag | Genbank | Species | Strain | PBP in rods | Pigment type | Remark | Length | Last change |
---|---|---|---|---|---|---|---|---|---|
MC7420_4701 homologs family | MC7420_4701 | ZP_05025511.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 455 | 11-30-2011 | ||
MC7420_4701 homologs family | Cyan7822_1857 | YP_003887117.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 457 | 11-30-2011 | |
MC7420_4701 homologs family | MicvaDRAFT_1724 | ZP_08491624.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | Sequence shortened at N-term (104 aa removed: MNSAATLIQQLPELSDAQFHQKYLKQKQGMRTLATILPQVEQQSLALRAVKLALKVNLKLGSKLAGTVKPEFQIATIKLIEKIPTSPLLKIQLLALTSSDMAIP) | 534 | 09-11-2012 |
MC7420_4701 homologs family | Osc7112_2212 | YP_007115088.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 638 | 04-24-2013 | |
MC7420_4701 homologs family | Osc10802DRAFT_3523 | Oscillatoria sp. | PCC10802 | PC+PEI | 550 | 06-12-2013 |
Model strains, Marine strains
Last update: 11 Sep 2012 8:18:52