E/F subclan 2 - Proteins related to lyases or lyase chaperones
[fasta] [only sure] [only unsure]
Description
Members of this group usually have PBS lyase HEAT repeats domains or at least Armadillo-type folds. Most of them are uncharacterized yet and there is no evidence that they are bona fide phycobilin lyases, though they are clearly related to the latter. Among them, CpeZ is not a lyase per se but it was found to significantly enhance the activity of the PEB lyase CpeY (Biswas et al., 2011).
References
- Biswas et al., 2011. Characterization of the activities of the CpeY, CpeZ, and CpeS bilin lyases in phycoerythrin biosynthesis in Fremyella diplosiphon strain UTEX 481 J Biol Chem, 286(41), 35509-21.
Gene | Locus tag | Genbank | Species | Strain | PBP in rods | Pigment type | Remark | Length | Last change |
---|---|---|---|---|---|---|---|---|---|
CpeZ family | sync_0500 | YP_729727.1 | Synechococcus sp. | CC9311 | PC+PEI+PEII | 3dA/CA4-A | N-term shortened (15aa removed by FP: LLLSPAKIVKSSSCV) | 208 | 09-26-2011 |
CpeZ family | Syncc9605_0430 | YP_380761.1 | Synechococcus sp. | CC9605 | PC+PEI+PEII | 3c | 212 | 09-26-2011 | |
CpeZ family | SH8109_0079 | ZP_05789880.1 | Synechococcus sp. | WH8109 | PC+PEI+PEII | 3bB | 212 | 09-26-2011 | |
CpeZ family | SYNW2012 | NP_898103.1 | Synechococcus sp. | WH8102 | PC+PEI+PEII | 3c | 206 | 09-26-2011 | |
CpeZ family | Syncc9902_1897 | YP_377898.1 | Synechococcus sp. | CC9902 | PC+PEI+PEII | 3dA/CA4-A | 209 | 09-26-2011 | |
CpeZ family | BL107_08936 | ZP_01469890.1 | Synechococcus sp. | BL107 | PC+PEI+PEII | 3dA/CA4-A | 209 | 09-26-2011 | |
CpeZ family | SynWH7803_0488 | YP_001224211.1 | Synechococcus sp. | WH7803 | PC+PEI+PEII | 3a | 205 | 09-26-2011 | |
CpeZ family | WH7805_06706 | ZP_01123341.1 | Synechococcus sp. | WH7805 | PC+PEI | 2 | 209 | 09-26-2011 | |
CpeZ family | RS9916_40216 | ZP_01473086.1 | Synechococcus sp. | RS9916 | PC+PEI+PEII | 3dA/CA4-A | 209 | 09-26-2011 | |
CpeZ family | SynRCC307_2052 | YP_001228308.1 | Synechococcus sp. | RCC307 | PC+PEI+PEII | 3eA | 205 | 09-26-2011 | |
CpeZ family | SCB02_010100004363 | ZP_07970142.1 | Synechococcus sp. | CB0205 | PC+PEI | 2 | 204 | 11-04-2011 | |
CpeZ family | S7335_2652 | ZP_05036218.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | 209 | 09-26-2011 | |
CpeZ family | Syn8016DRAFT_2750 | ZP_08957403.1 | Synechococcus sp. | WH8016 | PC+PEI+PEII | 3aA | 204 | 11-04-2011 | |
CpeZ family | NATL1_03871 | YP_001014216.1 | Prochlorococcus marinus | NATL1A | PEIII | high b/a | 198 | 09-26-2011 | |
CpeZ family | PMN2A_1673 | YP_292864.1 | Prochlorococcus marinus | NATL2A | PEIII | high b/a | 198 | 09-26-2011 | |
CpeZ family | Pro0339 | NP_874733.1 | Prochlorococcus marinus | SS120 (CCMP1375) | PEIII | high b/a | A block is missing in protomata | 202 | 09-26-2011 |
CpeZ family | P9211_03341 | YP_001550219.1 | Prochlorococcus marinus | MIT9211 | PEIII | High b/a | A block is missing in protomata | 200 | 09-26-2011 |
CpeZ family | P9303_22361 | YP_001018236.1 | Prochlorococcus sp. | MIT9303 | PEIII | high b/a | 210 | 09-26-2011 | |
CpeZ family | PMT1681 | NP_895508.1 | Prochlorococcus sp. | MIT9313 | PEIII | high b/a | 211 | 09-26-2011 | |
CpeZ family | CwatDRAFT_5981 | ZP_00514214.1 | Crocosphaera watsonii | WH8501 | PC+PEI | 204 | 09-26-2011 | ||
CpeZ family | PCC7424_5730 | YP_002381025.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 201 | 09-26-2011 | |
CpeZ family | PCC8801_4513 | YP_002364791.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 208 | 09-26-2011 | |
CpeZ family | Cyan7822_4046 | YP_003889246.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 201 | 09-26-2011 | |
CpeZ family | gi|47606673|gb|AAT36319.1| | AAT36319.1 | Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) | Fd33 (UTEX481/PCC7601) | PC+PEI | CA3 | 205 | 09-26-2011 | |
CpeZ family | gvip157 | NP_924133.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | 204 | 11-24-2011 | |
CpeZ family | GL6909_3531 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 204 | 06-06-2011 | ||
CpeZ family | Npun_R3805 | YP_001867132.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 202 | 09-26-2011 | |
CpeZ family | Tery_0995 | YP_720846.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | lower blastp hit on >Tery_0980 | 203 | 09-26-2011 | |
CpeZ family | Tery_0980 | YP_720834.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | Blastp hit on cpeZ (but lower than >Tery_0995) | 219 | 09-26-2011 | |
CpeZ family | LYNGBM3L_56070 | ZP_08427728.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 220 | 10-19-2011 | |
CpeZ family | CAJ73184.1| | CAJ73184.1 | Guillardia theta | CCMP2712 | Cr-PE 545 | n.a. | Low protoscan score | 229 | 10-28-2011 |
CpeZ family | CwatDRAFT_0406 | ZP_00518848.1 | Crocosphaera watsonii | WH8501 | PC+PEI | Low score, similar to Tery_0980 (IMS101) | 219 | 12-02-2011 | |
CpeZ family | CWATWH0003_0668 | EHJ14660.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 204 | 02-22-2012 | ||
CpeZ family | CWATWH0003_5315a1 | EHJ09924.1 | Crocosphaera watsonii | WH0003 | PC+PEI | Incomplete, 2nd copy? | 186 | 02-22-2012 | |
CpeZ family | MICAI_2660036 | ZP_10228479.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 203 | 08-22-2012 | |
CpeZ family | SynWH8020_cpeZ | AAA27336.1 | Synechococcus sp. | WH8020 | PC+PEI+PEII | 3dA/CA4-A | N-term extended (22 aa added) | 208 | 08-27-2012 |
CpeZ family | Mic7113_4747 | YP_007123826.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 204 | 04-23-2013 | |
CpeZ family | Ple7327_1946 | YP_007080845.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 202 | 04-23-2013 | ||
CpeZ family | Osc7112_1034 | YP_007114008.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 204 | 04-23-2013 | |
CpeZ family | GLO73106DRAFT_00012690 | ZP_21051605.1 | Gloeocapsa sp. | PCC73106 | PC+PEI | 204 | 04-23-2013 | ||
CpeZ family | Pse7367_3889 | YP_007083546.1 | Pseudanabaena sp. | PCC7367 | PC+PEI | 206 | 04-23-2013 | ||
CpeZ family | Lepto7376_1198 | YP_007070389.1 | Leptolyngbya sp. | PCC7376 | PC+PEI | 202 | 04-23-2013 | ||
CpeZ family | Xen7305DRAFT_00032340 | ZP_21054999.1 | Xenococcus sp. | PCC7305 | PC+PEI | 209 | 04-23-2013 | ||
CpeZ family | Sta7437_3350 | YP_007133822.1 | Stanieria cyanosphaera | PCC7437 | PC+PEI | 202 | 04-29-2013 | ||
CpeZ family | Cha6605_4052 | YP_007098535.1 | Chamaesiphon minutus | PCC6605 | PC+PEI | 204 | 04-29-2013 | ||
CpeZ family | Cal6303_1006 | YP_007136043.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 202 | 04-29-2013 | |
CpeZ family | Osc10802DRAFT_5371 | Oscillatoria sp. | PCC10802 | PC+PEI | This sequence has a long N-term which has similarity to C-term end of CpeC (possible sequencing/assembly error) | 281 | 07-02-2013 | ||
CpeZ family | ZP_18907654 | ZP_18907654.1 | Leptolyngbya sp. | PCC7375 | PC+PEI | 2 | 205 | 06-20-2013 | |
IaiH family | sync_2351 | YP_731548.1 | Synechococcus sp. | CC9311 | PC+PEI+PEII | 3dA/CA4-A | 269 | 10-26-2011 | |
IaiH family | Syncc9605_2060 | YP_382355.1 | Synechococcus sp. | CC9605 | PC+PEI+PEII | 3c | 270 | 10-26-2011 | |
IaiH family | SH8109_1105 | ZP_05789908.1 | Synechococcus sp. | WH8109 | PC+PEI+PEII | 3bB | 270 | 10-26-2011 | |
IaiH family | SYNW0621 | NP_896714.1 | Synechococcus sp. | WH8102 | PC+PEI+PEII | 3c | 269 | 10-26-2011 | |
IaiH family | Syncc9902_0612 | YP_376624.1 | Synechococcus sp. | CC9902 | PC+PEI+PEII | 3dA/CA4-A | 270 | 10-26-2011 | |
IaiH family | BL107_16005 | ZP_01468434.1 | Synechococcus sp. | BL107 | PC+PEI+PEII | 3dA/CA4-A | 270 | 10-26-2011 | |
IaiH family | SynWH7803_2056 | YP_001225779.1 | Synechococcus sp. | WH7803 | PC+PEI+PEII | 3a | 269 | 10-26-2011 | |
IaiH family | WH7805_12348 | ZP_01122851.1 | Synechococcus sp. | WH7805 | PC+PEI | 2 | 269 | 10-26-2011 | |
IaiH family | RS9917_08150 | ZP_01081220.1 | Synechococcus sp. | RS9917 | PC | 1 | 268 | 10-26-2011 | |
IaiH family | RS9916_34787 | ZP_01470988.1 | Synechococcus sp. | RS9916 | PC+PEI+PEII | 3dA/CA4-A | 269 | 10-26-2011 | |
IaiH family | WH5701_15416 | ZP_01084128.1 | Synechococcus sp. | WH5701 | PC | 1 | 274 | 10-26-2011 | |
IaiH family | SynRCC307_1951 | YP_001228207.1 | Synechococcus sp. | RCC307 | PC+PEI+PEII | 3eA | 258 | 10-26-2011 | |
IaiH family | SCB01_010100011409 | ZP_07974267.1 | Synechococcus sp. | CB0101 | PC | 1 | 266 | 11-04-2011 | |
IaiH family | SCB02_010100005388 | ZP_07970337.1 | Synechococcus sp. | CB0205 | PC+PEI | 2 | MAASPYESPKGSSDLDFDSEL not present in refseq | 266 | 11-04-2011 |
IaiH family | S7335_4906 | ZP_05038464.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | 255 | 10-26-2011 | |
IaiH family | SYNPCC7002_A1412 | YP_001734659.1 | Synechococcus sp. | PCC7002 | PC | 1 | 246 | 10-26-2011 | |
IaiH family | CPCC7001_263 | ZP_05044076.1 | Cyanobium sp. | PCC7001 | PC | 1 | 277 | 10-26-2011 | |
IaiH family | Syn8016DRAFT_2224 | ZP_08956879.1 | Synechococcus sp. | WH8016 | PC+PEI+PEII | 3aA | 269 | 11-04-2011 | |
IaiH family | PMM1480 | NP_893597.1 | Prochlorococcus marinus | MED4 (CCMP1986/CCMP1378) | beta-PEIII | low b/a | 256 | 10-26-2011 | |
IaiH family | P9515_16601 | YP_001011974.1 | Prochlorococcus marinus | MIT9515 | beta-PEIII | low b/a | 256 | 10-26-2011 | |
IaiH family | P9301_16701 | YP_001091894.1 | Prochlorococcus marinus | MIT9301 | beta-PEIII | low b/a | 255 | 10-26-2011 | |
IaiH family | A9601_16821 | YP_001010072.1 | Prochlorococcus marinus | AS9601 | beta-PEIII | low b/a | 255 | 10-26-2011 | |
IaiH family | P9215_17481 | YP_001484947.1 | Prochlorococcus marinus | MIT9215 | beta-PEIII | low b/a | 255 | 10-26-2011 | |
IaiH family | PMT9312_1573 | YP_398069.1 | Prochlorococcus marinus | MIT9312 | beta-PEIII | low b/a | 255 | 10-26-2011 | |
IaiH family | P9202_32 | ZP_05137436.1 | Prochlorococcus marinus | MIT9202 | beta-PEIII | low b/a | 255 | 10-26-2011 | |
IaiH family | NATL1_18791 | YP_001015699.1 | Prochlorococcus marinus | NATL1A | PEIII | high b/a | 269 | 10-26-2011 | |
IaiH family | PMN2A_1010 | YP_292203.1 | Prochlorococcus marinus | NATL2A | PEIII | high b/a | 269 | 10-26-2011 | |
IaiH family | Pro1634 | NP_876025.1 | Prochlorococcus marinus | SS120 (CCMP1375) | PEIII | high b/a | 269 | 10-26-2011 | |
IaiH family | P9211_16001 | YP_001551485.1 | Prochlorococcus marinus | MIT9211 | PEIII | High b/a | 269 | 10-26-2011 | |
IaiH family | PUH18301_1815 | Prochlorococcus marinus | UH18301 | beta-PEIII | low b/a | 255 | 10-26-2011 | ||
IaiH family | P9303_04441 | YP_001016461.1 | Prochlorococcus sp. | MIT9303 | PEIII | high b/a | 263 | 10-26-2011 | |
IaiH family | PMT1501 | NP_895328.1 | Prochlorococcus sp. | MIT9313 | PEIII | high b/a | 263 | 10-26-2011 | |
IaiH family | slr1098 | NP_440077.1 | Synechocystis sp. | PCC6803 (ATCC27184) | PC | 1 | 252 | 10-26-2011 | |
IaiH family | AM1_2319 | YP_001516644.1 | Acaryochloris marina | MBIC11017 (AM1) | PC | 1 | 252 | 10-26-2011 | |
IaiH family | alr4537 | NP_488577.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 252 | 10-26-2011 | ||
IaiH family | Ava_1404 | YP_321922.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | 252 | 10-26-2011 | ||
IaiH family | Aazo_0466 | YP_003720123.1 | Anabaena (Nostoc) azollae | 0708 | PC+PEC | 254 | 10-26-2011 | ||
IaiH family | AmaxDRAFT_1788 | ZP_03272970.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 261 | 10-26-2011 | |
IaiH family | CwatDRAFT_4428 | ZP_00515633.1 | Crocosphaera watsonii | WH8501 | PC+PEI | 250 | 10-26-2011 | ||
IaiH family | cce_0658 | YP_001802075.1 | Cyanothece sp. | ATCC51142 | PC | 1 | 250 | 10-26-2011 | |
IaiH family | PCC7424_2038 | YP_002377336.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 246 | 10-26-2011 | |
IaiH family | Cyan7425_0542 | YP_002481294.1 | Cyanothece sp. | PCC7425 | PC | 1 | 250 | 10-26-2011 | |
IaiH family | PCC8801_3723 | YP_002373834.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 249 | 10-26-2011 | |
IaiH family | Cyan8802_3776 | YP_003139418.1 | Cyanothece sp. | PCC8802 | PC | 1 | 249 | 10-26-2011 | |
IaiH family | CY0110_28669 | ZP_01730141.1 | Cyanothece sp. | CCY0110 | PC | 1 | 250 | 10-26-2011 | |
IaiH family | Cyan7822_5445 | YP_003890596.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 243 | 10-26-2011 | |
IaiH family | FJSC11DRAFT_1220 | ZP_08985014.1 | Fischerella sp. (Mastigocladus laminosus) | JSC-11 | PC+PEC | 252 | 11-04-2011 | ||
IaiH family | gll3007 | NP_925953.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | 240 | 10-26-2011 | |
IaiH family | GL6909_0099 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 247 | 10-26-2011 | ||
IaiH family | L8106_07506 | ZP_01622090.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | N-term extended by FP (New start: complement(37527); stretch added: MEDEKLSVIHSPEAWESPLDH) | 247 | 09-26-2011 |
IaiH family | MC7420_1911 | ZP_05025197.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 252 | 10-26-2011 | ||
IaiH family | MAE_48080 | YP_001659822.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | 247 | 10-26-2011 | |
IaiH family | N9414_19727 | ZP_01629226.1 | Nodularia spumigena | CCY9414 | PC | 1 | 252 | 10-26-2011 | |
IaiH family | Npun_F4500 | YP_001867809.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 252 | 10-26-2011 | |
IaiH family | Synpcc7942_1752 | YP_400769.1 | Synechococcus elongatus | PCC7942 | PC | 1 | 250 | 10-26-2011 | |
IaiH family | syc2339_d | YP_173049.1 | Synechococcus elongatus | PCC6301 (ATCC 27144) | PC | 1 | 250 | 10-26-2011 | |
IaiH family | CYB_2106 | YP_478315.1 | Synechococcus sp. | JA-2-3B'a(2-13) | PC | 1 | 242 | 10-26-2011 | |
IaiH family | CYA_0113 | YP_473606.1 | Synechococcus sp. | JA-3-3Ab | PC | 1 | 239 | 10-26-2011 | |
IaiH family | tll0329 | NP_681119.1 | Thermosynechococcus elongatus | BP-1 | PC | 1 | 251 | 10-26-2011 | |
IaiH family | Tery_4484 | YP_723943.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 246 | 10-26-2011 | ||
IaiH family | PCC_0182 | YP_002048842.1 | Paulinella chromatophora | M0880 | PC | 1 | 267 | 11-02-2011 | |
IaiH family | CRD_00800 | ZP_06303837.1 | Raphidiopsis brookii | D9 | PC | 1 | 252 | 11-02-2011 | |
IaiH family | CRC_00053 | ZP_06306749.1 | Cylindrospermopsis raciborskii | CS-505 | PC | 1 | 252 | 11-02-2011 | |
IaiH family | IPF_5485 | CAO87094.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | 247 | 11-02-2011 | |
IaiH family | NIES39_Q01300 | BAI94138.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 261 | 11-02-2011 | |
IaiH family | MicvaDRAFT_2477 | ZP_08493978.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 248 | 11-02-2011 | |
IaiH family | LYNGBM3L_64630 | ZP_08431563.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 252 | 11-02-2011 | |
IaiH family | OSCI_940010 | ZP_07109377.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 248 | 11-02-2011 | |
IaiH family | Cy51472DRAFT_2922 | ZP_08974126.1 | Cyanothece sp. | ATCC51472 | PC | 1 | 250 | 01-10-2012 | |
IaiH family | AplaP_010100011636 | ZP_06382319.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | 261 | 01-24-2012 | |
IaiH family | ACCM5_010100001232 | ZP_09245880.1 | Acaryochloris sp. | CCMEE5410 | APC only | 252 | 01-24-2012 | ||
IaiH family | CWATWH0003_2056 | EHJ13243.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 250 | 02-22-2012 | ||
IaiH family | MICAI_2780007 | ZP_10228668.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 247 | 08-22-2012 | |
IaiH family | MICAG_660025 | CCI29018.1 | Microcystis aeruginosa | PCC9808 | PC | 1 | 247 | 08-22-2012 | |
IaiH family | MICAB_2830008 | CCH96991.1 | Microcystis aeruginosa | PCC9717 | PC | 1 | 247 | 08-23-2012 | |
IaiH family | MICAK_320003 | CCI37314.1 | Microcystis aeruginosa | PCC9701 | PC | 1 | 247 | 08-23-2012 | |
IaiH family | MICAC_5470010 | CCI04185.1 | Microcystis aeruginosa | PCC9443 | PC | 1 | 247 | 08-23-2012 | |
IaiH family | MICAD_2620024 | CCI07607.1 | Microcystis aeruginosa | PCC7941 | PC | 1 | 247 | 08-23-2012 | |
IaiH family | Osc7112_4012 | YP_007116762.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 248 | 04-24-2013 | |
IaiH family | Ple7327_4580 | YP_007083233.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 252 | 04-24-2013 | ||
IaiH family | Chro_4094 | YP_007093367.1 | Chroococcidiopsis thermalis | PCC7203 | PC+PEC | 252 | 04-24-2013 | ||
IaiH family | Mic7113_3327 | YP_007122465.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 252 | 04-24-2013 | |
IaiH family | Lepto7376_3254 | YP_007072316.1 | Leptolyngbya sp. | PCC7376 | PC+PEI | 246 | 04-24-2013 | ||
IaiH family | Glo7428_1948 | YP_007127656.1 | Gloeocapsa sp. | PCC7428 | PC | 253 | 04-24-2013 | ||
IaiH family | Anacy_4866 | YP_007159119.1 | Anabaena cylindrica | PCC7122 | PC+PEC | 252 | 04-24-2013 | ||
IaiH family | Nos7524_2481 | YP_007075918.1 | Nostoc sp. | PCC7524 | PC+PEC | 252 | 04-24-2013 | ||
IaiH family | Xen7305DRAFT_00003450 | ZP_21057788.1 | Xenococcus sp. | PCC7305 | PC+PEI | 254 | 04-24-2013 | ||
IaiH family | Syn7509DRAFT_00026090 | ZP_21040934.1 | Synechocystis sp. | PCC7509 | PC | 252 | 04-24-2013 | ||
IaiH family | ZP_20932525 | ZP_20932525.1 | Microcystis aeruginosa | TAIHU98 | PC | 1 | 247 | 04-24-2013 | |
IaiH family | Dacsa_2567 | YP_007172513.1 | Dactylococcopsis salina | PCC8305 | 253 | 04-24-2013 | |||
IaiH family | Cyast_1343 | YP_007164957.1 | Cyanobacterium stanieri | PCC7202 | PC | 247 | 04-24-2013 | ||
IaiH family | Cylst_1364 | YP_007146333.1 | Cylindrospermum stagnale | PCC7417 | PC+PEC | 252 | 04-24-2013 | ||
IaiH family | Riv7116_2387 | YP_007055450.1 | Rivularia sp. | PCC7116 | PC+PEC | 252 | 04-24-2013 | ||
IaiH family | GLO73106DRAFT_00021120 | ZP_21050727.1 | Gloeocapsa sp. | PCC73106 | PC+PEI | 251 | 04-24-2013 | ||
IaiH family | PCC7418_1206 | YP_007167622.1 | Halothece sp. | PCC7418 | PC | 264 | 04-24-2013 | ||
IaiH family | Pse7429DRAFT_0263 | ZP_21064643.1 | Pseudanabaena sp. (biceps) | PCC7429 | PC | 253 | 04-24-2013 | ||
IaiH family | Pse7367_0988 | YP_007101715.1 | Pseudanabaena sp. | PCC7367 | PC+PEI | 248 | 04-24-2013 | ||
IaiH family | ZP_18908495 | ZP_18908495.1 | Leptolyngbya sp. | PCC7375 | PC+PEI | 2 | 251 | 04-24-2013 | |
IaiH family | Oscil6304_5734 | YP_007089129.1 | Oscillatoria acuminata | PCC6304 (SAG 1449-3) | PC | 247 | 04-29-2013 | ||
IaiH family | Cri9333_0885 | YP_007141311.1 | Crinalium epipsammum | PCC9333 | PC | 252 | 04-29-2013 | ||
IaiH family | GEI7407_1580 | YP_007109123.1 | Geitlerinema sp. | PCC7407 | PC | 250 | 04-29-2013 | ||
IaiH family | MICCA_1930013 | ZP_18816492.1 | Microcystis aeruginosa | PCC9432 | PC | 1 | 247 | 04-29-2013 | |
IaiH family | Sta7437_0351 | YP_007130929.1 | Stanieria cyanosphaera | PCC7437 | PC+PEI | 252 | 04-29-2013 | ||
IaiH family | Cal6303_5536 | YP_007140388.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 252 | 04-29-2013 | |
IaiH family | Cyagr_3038 | YP_007047461.1 | Cyanobium gracile | PCC6307 | PC | 266 | 04-29-2013 | ||
IaiH family | Syn6312_3460 | YP_007063030.1 | Synechococcus sp. | PCC6312 | PC | 249 | 04-29-2013 | ||
IaiH family | Cal7507_4545 | YP_007067746.1 | Calothrix sp. | PCC7507 | PC+PEC | 252 | 04-29-2013 | ||
IaiH family | Nos7107_5208 | YP_007052867.1 | Nostoc sp. | PCC7107 | PC+PEC | 252 | 04-29-2013 | ||
IaiH family | Cha6605_0246 | YP_007095075.1 | Chamaesiphon minutus | PCC6605 | PC+PEI | 257 | 04-29-2013 | ||
IaiH family | Cyan10605_1845 | YP_007161991.1 | Cyanobacterium aponimum | PCC10605 | 248 | 04-29-2013 | |||
IaiH family | Lep6406DRAFT_00001360 | ZP_21048597.1 | Leptolyngbya sp. | PCC6406 | PC+PEC | 260 | 04-29-2013 | ||
IaiH family | Syn7502_01130 | YP_007105374.1 | Synechococcus sp. | PCC7502 | PC | 263 | 04-29-2013 | ||
IaiH family | LepboDRAFT_3635 | Leptolyngbya boryana | PCC6306 | PC | 251 | 06-11-2013 | |||
IaiH family | Fis9431DRAFT_3532 | Fischerella sp. | PCC9431 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | FIS9605DRAFT_00906 | Fischerella sp. | PCC9605 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | FisPCC73103_2012 | Fischerella muscicola | PCC73103 (SAG 1427-1) | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | Scytonema_PCC7110_joined_9529 | Scytonema hofmanni | PCC7110 | PC+PEC | 253 | 06-12-2013 | |||
IaiH family | Osc10802DRAFT_4729 | Oscillatoria sp. | PCC10802 | PC+PEI | 248 | 06-12-2013 | |||
IaiH family | PCC9339DRAFT_01656 | Fischerella sp. | PCC9339 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | Ana7108_4503 | Anabaena sp. | PCC7108 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | Chloroglopsis_PCC9212_joined_4547 | Chlorogloeopsis sp. | PCC9212 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | UYC_01049 | Chlorogloeopsis fritschii | PCC6912 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | FisPCC7414_6969 | Fischerella muscicola | PCC7414 | PC+PEC | 252 | 06-12-2013 | |||
IaiH family | Fischerella_sp._PCC7521_3782 | Fischerella thermalis | PCC7521 | PC+PEC | 252 | 06-12-2013 | |||
L8106_11777 homologs family | L8106_11777 | ZP_01621519.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 316 | 09-26-2011 | |
L8106_11777 homologs family | NIES39_O04890 | BAI93736.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 314 | 12-01-2011 | |
L8106_11777 homologs family | AmaxDRAFT_5407 | ZP_03276581.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 292 | 12-01-2011 | |
L8106_11777 homologs family | AplaP_010100002137 | ZP_06380464.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | Incomplete n-term (end of contig). Almost identical to homologs in other Arthrospira species. | 179 | 08-27-2012 |
L8106_16949 homologs family | L8106_16949 | ZP_01620421.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 419 | 09-26-2011 | |
L8106_16949 homologs family | MicvaDRAFT_3571 | ZP_08493473.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 430 | 12-05-2011 | |
L8106_16949 homologs family | OSCI_1070009 | ZP_07109619.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 452 | 12-05-2011 | |
L8106_16949 homologs family | N9414_05274 | ZP_01629849.1 | Nodularia spumigena | CCY9414 | PC | 1 | 437 | 12-05-2011 | |
L8106_16949 homologs family | Npun_F1530 | YP_001865162.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 432 | 06-12-2013 | |
L8106_16949 homologs family | Tery_0072 | YP_720054.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 442 | 12-05-2011 | ||
L8106_16949 homologs family | all0605 | NP_484649.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 398 | 12-05-2011 | ||
L8106_16949 homologs family | Ava_4537 | YP_325030.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | 400 | 12-05-2011 | ||
L8106_16949 homologs family | Cyan8802_3638 | YP_003139288.1 | Cyanothece sp. | PCC8802 | PC | 1 | 395 | 12-05-2011 | |
L8106_16949 homologs family | PCC8801_2470 | YP_002372635.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 395 | 12-05-2011 | |
L8106_16949 homologs family | FJSC11DRAFT_0884 | ZP_08984678.1 | Fischerella sp. (Mastigocladus laminosus) | JSC-11 | PC+PEC | 404 | 12-05-2011 | ||
L8106_16949 homologs family | CwatDRAFT_4661 | ZP_00515205.1 | Crocosphaera watsonii | WH8501 | PC+PEI | 377 | 12-05-2011 | ||
L8106_16949 homologs family | Cyan7822_3567 | YP_003888783.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 391 | 12-05-2011 | |
L8106_16949 homologs family | NIES39_H00170 | BAI90942.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 410 | 12-05-2011 | |
L8106_16949 homologs family | PCC7424_1681 | YP_002376985.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 388 | 12-05-2011 | |
L8106_16949 homologs family | LYNGBM3L_62310 | ZP_08431195.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 397 | 12-05-2011 | |
L8106_16949 homologs family | MC7420_2776 | ZP_05030778.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 398 | 12-05-2011 | ||
L8106_16949 homologs family | CY0110_30523 | ZP_01730379.1 | Cyanothece sp. | CCY0110 | PC | 1 | 381 | 12-05-2011 | |
L8106_16949 homologs family | AmaxDRAFT_3716 | ZP_03274892.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 414 | 12-05-2011 | |
L8106_16949 homologs family | cce_2919 | YP_001804333.1 | Cyanothece sp. | ATCC51142 | PC | 1 | 377 | 12-05-2011 | |
L8106_16949 homologs family | MAE_60750 | YP_001661089.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | 396 | 12-05-2011 | |
L8106_16949 homologs family | IPF_2545 | CAO87418.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | 396 | 12-05-2011 | |
L8106_16949 homologs family | AM1_2983 | YP_001517295.1 | Acaryochloris marina | MBIC11017 (AM1) | PC | 1 | 395 | 12-05-2011 | |
L8106_16949 homologs family | SYNPCC7002_A1619 | YP_001734865.1 | Synechococcus sp. | PCC7002 | PC | 1 | 393 | 12-05-2011 | |
L8106_16949 homologs family | S7335_5516 | ZP_05039071.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | 439 | 12-05-2011 | |
L8106_16949 homologs family | GL6909_2003 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 366 | 12-05-2011 | ||
L8106_16949 homologs family | Cy51472DRAFT_4412 | ZP_08975615.1 | Cyanothece sp. | ATCC51472 | PC | 1 | 377 | 01-10-2012 | |
L8106_16949 homologs family | AplaP_010100015438 | ZP_06383071.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | 410 | 01-24-2012 | |
L8106_16949 homologs family | ACCM5_010100005086 | ZP_09246638.1 | Acaryochloris sp. | CCMEE5410 | APC only | 395 | 01-24-2012 | ||
L8106_16949 homologs family | CWATWH0003_1645 | EHJ13671.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 377 | 02-22-2012 | ||
L8106_16949 homologs family | MICAI_840009 | ZP_10230413.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 396 | 08-22-2012 | |
L8106_16949 homologs family | MICAG_840013 | CCI29493.1 | Microcystis aeruginosa | PCC9808 | PC | 1 | 396 | 08-22-2012 | |
L8106_16949 homologs family | MICAB_5340001 | CCH98773.1 | Microcystis aeruginosa | PCC9717 | PC | 1 | 396 | 08-23-2012 | |
L8106_16949 homologs family | MICAK_1050005 | CCI34771.1 | Microcystis aeruginosa | PCC9701 | PC | 1 | 396 | 08-23-2012 | |
L8106_16949 homologs family | MICAC_4580012 | CCI03406.1 | Microcystis aeruginosa | PCC9443 | PC | 1 | 396 | 08-23-2012 | |
L8106_16949 homologs family | MICAD_840005 | CCI09780.1 | Microcystis aeruginosa | PCC7941 | PC | 1 | 396 | 08-23-2012 | |
L8106_16949 homologs family | Nos7524_4345 | YP_007077701.1 | Nostoc sp. | PCC7524 | PC+PEC | 395 | 04-24-2013 | ||
L8106_16949 homologs family | Syn7509DRAFT_00026430 | ZP_21040968.1 | Synechocystis sp. | PCC7509 | PC | 429 | 04-24-2013 | ||
L8106_16949 homologs family | ZP_20933301 | ZP_20933301.1 | Microcystis aeruginosa | TAIHU98 | PC | 1 | 396 | 04-24-2013 | |
L8106_16949 homologs family | Ple7327_1571 | YP_007080500.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 417 | 04-24-2013 | ||
L8106_16949 homologs family | Osc7112_1244 | YP_007114204.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 438 | 04-24-2013 | |
L8106_16949 homologs family | Riv7116_0550 | YP_007053692.1 | Rivularia sp. | PCC7116 | PC+PEC | 401 | 04-24-2013 | ||
L8106_16949 homologs family | Chro_3567 | YP_007092891.1 | Chroococcidiopsis thermalis | PCC7203 | PC+PEC | 464 | 04-24-2013 | ||
L8106_16949 homologs family | Mic7113_0135 | YP_007119479.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 434 | 04-24-2013 | |
L8106_16949 homologs family | Glo7428_1959 | YP_007127666.1 | Gloeocapsa sp. | PCC7428 | PC | 435 | 04-24-2013 | ||
L8106_16949 homologs family | Lepto7376_4351 | YP_007073293.1 | Leptolyngbya sp. | PCC7376 | PC+PEI | 389 | 04-24-2013 | ||
L8106_16949 homologs family | Pse7367_2344 | YP_007103033.1 | Pseudanabaena sp. | PCC7367 | PC+PEI | 423 | 04-24-2013 | ||
L8106_16949 homologs family | Xen7305DRAFT_00042220 | ZP_21054004.1 | Xenococcus sp. | PCC7305 | PC+PEI | 412 | 04-24-2013 | ||
L8106_16949 homologs family | MICCA_3420010 | ZP_18818233.1 | Microcystis aeruginosa | PCC9432 | PC | 1 | 396 | 04-29-2013 | |
L8106_16949 homologs family | Cal7507_2105 | YP_007065381.1 | Calothrix sp. | PCC7507 | PC+PEC | 433 | 04-29-2013 | ||
L8106_16949 homologs family | Nos7107_2254 | YP_007050016.1 | Nostoc sp. | PCC7107 | PC+PEC | 396 | 04-29-2013 | ||
L8106_16949 homologs family | Oscil6304_0495 | YP_007084161.1 | Oscillatoria acuminata | PCC6304 (SAG 1449-3) | PC | 482 | 04-29-2013 | ||
L8106_16949 homologs family | Cri9333_2973 | YP_007143322.1 | Crinalium epipsammum | PCC9333 | PC | 429 | 04-29-2013 | ||
L8106_16949 homologs family | Cha6605_0750 | YP_007095548.1 | Chamaesiphon minutus | PCC6605 | PC+PEI | 451 | 04-29-2013 | ||
L8106_16949 homologs family | LepboDRAFT_3472 | Leptolyngbya boryana | PCC6306 | PC | 425 | 06-11-2013 | |||
L8106_16949 homologs family | Fis9431DRAFT_4372 | Fischerella sp. | PCC9431 | PC+PEC | 364 | 06-12-2013 | |||
L8106_16949 homologs family | FIS9605DRAFT_00990 | Fischerella sp. | PCC9605 | PC+PEC | 417 | 06-12-2013 | |||
L8106_16949 homologs family | FisPCC73103_4572 | Fischerella muscicola | PCC73103 (SAG 1427-1) | PC+PEC | 364 | 06-12-2013 | |||
L8106_16949 homologs family | Scytonema_PCC7110_joined_8104 | Scytonema hofmanni | PCC7110 | PC+PEC | 429 | 06-12-2013 | |||
L8106_16949 homologs family | Osc10802DRAFT_0992 | Oscillatoria sp. | PCC10802 | PC+PEI | 437 | 06-12-2013 | |||
L8106_16949 homologs family | PCC9339DRAFT_01500 | Fischerella sp. | PCC9339 | PC+PEC | 364 | 06-12-2013 | |||
L8106_16949 homologs family | Chloroglopsis_PCC9212_joined_5948 | Chlorogloeopsis sp. | PCC9212 | PC+PEC | 432 | 06-12-2013 | |||
L8106_16949 homologs family | UYC_03057 | Chlorogloeopsis fritschii | PCC6912 | PC+PEC | 432 | 06-12-2013 | |||
L8106_16949 homologs family | FisPCC7414_5095 | Fischerella muscicola | PCC7414 | PC+PEC | 404 | 06-12-2013 | |||
L8106_16949 homologs family | Fischerella_sp._PCC7521_613 | Fischerella thermalis | PCC7521 | PC+PEC | 404 | 06-12-2013 | |||
L8106_22089 homologs family | L8106_22089 | ZP_01623387.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 314 | 09-26-2011 | |
L8106_22089 homologs family | NIES39_A07090 | BAI88547.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 360 | 12-06-2011 | |
L8106_22089 homologs family | AmaxDRAFT_0777 | ZP_03271959.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 334 | 12-06-2011 | |
L8106_22089 homologs family | Tery_5007 | YP_724393.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 398 | 12-06-2011 | ||
L8106_22089 homologs family | MC7420_2176 | ZP_05026788.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 417 | 12-06-2011 | ||
L8106_22089 homologs family | OSCI_2990020 | ZP_07111171.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 429 | 12-06-2011 | |
L8106_22089 homologs family | MicvaDRAFT_5105 | ZP_08494867.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 397 | 12-06-2011 | |
L8106_22089 homologs family | LYNGBM3L_34780 | ZP_08427350.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 422 | 12-06-2011 | |
L8106_22089 homologs family | Npun_R4663 | YP_001867963.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 380 | 12-06-2011 | |
L8106_22089 homologs family | N9414_18048 | ZP_01631680.1 | Nodularia spumigena | CCY9414 | PC | 1 | 394 | 12-06-2011 | |
L8106_22089 homologs family | all3549+all3550 | NP_487589.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | frameshift (or sequencing error) in all3550 | 389 | 01-10-2012 | |
L8106_22089 homologs family | Ava_3528 | YP_324030.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | 389 | 12-06-2011 | ||
L8106_22089 homologs family | Cyan8802_0724 | YP_003136498.1 | Cyanothece sp. | PCC8802 | PC | 1 | 392 | 12-06-2011 | |
L8106_22089 homologs family | PCC8801_0696 | YP_002370937.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 392 | 12-06-2011 | |
L8106_22089 homologs family | FJSC11DRAFT_4556 | ZP_08988348.1 | Fischerella sp. (Mastigocladus laminosus) | JSC-11 | PC+PEC | 333 | 12-06-2011 | ||
L8106_22089 homologs family | cce_2926 | YP_001804340.1 | Cyanothece sp. | ATCC51142 | PC | 1 | 391 | 12-06-2011 | |
L8106_22089 homologs family | Cyan7822_4402 | YP_003889591.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 388 | 12-06-2011 | |
L8106_22089 homologs family | CY0110_02889 | ZP_01727378.1 | Cyanothece sp. | CCY0110 | PC | 1 | 394 | 12-06-2011 | |
L8106_22089 homologs family | Aazo_5152 | YP_003723334.1 | Anabaena (Nostoc) azollae | 0708 | PC+PEC | 358 | 12-06-2011 | ||
L8106_22089 homologs family | MAE_36470 | YP_001658661.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | N-term shortened (18 aa removed) | 364 | 08-28-2012 |
L8106_22089 homologs family | IPF_5551 | CAO86824.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | Incomplete sequence. Another chunk is in IPF_6118 (CAO87604.1) | 325 | 01-10-2012 |
L8106_22089 homologs family | CwatDRAFT_0171 | ZP_00519405.1 | Crocosphaera watsonii | WH8501 | PC+PEI | split between 3 different contigs: ZP_00517336.1 (CwatDRAFT_2581), ZP_00513741.1 (CwatDRAFT_6637) and ZP_00519405.1 (CwatDRAFT_0171) | 107 | 08-29-2012 | |
L8106_22089 homologs family | GL6909_1567 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 373 | 12-06-2011 | ||
L8106_22089 homologs family | Cy51472DRAFT_4419 | ZP_08975622.1 | Cyanothece sp. | ATCC51472 | PC | 1 | 391 | 01-10-2012 | |
L8106_22089 homologs family | AplaP_010100006555 | ZP_06381327.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | 332 | 01-24-2012 | |
L8106_22089 homologs family | MICAI_2510011 | ZP_10228186.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 364 | 08-22-2012 | |
L8106_22089 homologs family | MICAG_1620006 | CCI22083.1 | Microcystis aeruginosa | PCC9808 | PC | 1 | 367 | 08-22-2012 | |
L8106_22089 homologs family | MICAB_4560020 | CCH98232.1 | Microcystis aeruginosa | PCC9717 | PC | 1 | 364 | 08-23-2012 | |
L8106_22089 homologs family | MICAK_1200005 | CCI34961.1 | Microcystis aeruginosa | PCC9701 | PC | 1 | 367 | 08-23-2012 | |
L8106_22089 homologs family | MICAC_1420008 | CCI00959.1 | Microcystis aeruginosa | PCC9443 | PC | 1 | 366 | 08-23-2012 | |
L8106_22089 homologs family | MICAD_1710014 | CCI06343.1 | Microcystis aeruginosa | PCC7941 | PC | 1 | 367 | 08-23-2012 | |
L8106_22089 homologs family | Ple7327_1958 | YP_007080856.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 366 | 04-24-2013 | ||
L8106_22089 homologs family | Nos7524_5290 | YP_007078610.1 | Nostoc sp. | PCC7524 | PC+PEC | 394 | 04-24-2013 | ||
L8106_22089 homologs family | Cylst_6105 | YP_007150756.1 | Cylindrospermum stagnale | PCC7417 | PC+PEC | 391 | 04-24-2013 | ||
L8106_22089 homologs family | ZP_20934303 | ZP_20934303.1 | Microcystis aeruginosa | TAIHU98 | PC | 1 | 367 | 04-24-2013 | |
L8106_22089 homologs family | IPF_6118 | CAO87604.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | Shorter than other L8106_22089 homologs | 251 | 04-24-2013 |
L8106_22089 homologs family | Riv7116_5847 | YP_007058758.1 | Rivularia sp. | PCC7116 | PC+PEC | 369 | 04-24-2013 | ||
L8106_22089 homologs family | Osc7112_4556 | YP_007117267.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 397 | 04-24-2013 | |
L8106_22089 homologs family | Anacy_5157 | YP_007159401.1 | Anabaena cylindrica | PCC7122 | PC+PEC | 385 | 04-24-2013 | ||
L8106_22089 homologs family | Nos7107_0871 | YP_007048687.1 | Nostoc sp. | PCC7107 | PC+PEC | 399 | 04-29-2013 | ||
L8106_22089 homologs family | MICCA_2560018 | ZP_18817326.1 | Microcystis aeruginosa | PCC9432 | PC | 1 | 367 | 04-29-2013 | |
L8106_22089 homologs family | Cal6303_4175 | YP_007139061.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 394 | 04-29-2013 | |
L8106_22089 homologs family | GEI7407_1102 | YP_007108651.1 | Geitlerinema sp. | PCC7407 | PC | 451 | 04-29-2013 | ||
L8106_22089 homologs family | Cal7507_4899 | YP_007068086.1 | Calothrix sp. | PCC7507 | PC+PEC | 371 | 04-29-2013 | ||
L8106_22089 homologs family | LepboDRAFT_2621 | Leptolyngbya boryana | PCC6306 | PC | 322 | 06-11-2013 | |||
L8106_22089 homologs family | Fis9431DRAFT_1567 | Fischerella sp. | PCC9431 | PC+PEC | 333 | 06-12-2013 | |||
L8106_22089 homologs family | FIS9605DRAFT_01162 | Fischerella sp. | PCC9605 | PC+PEC | 378 | 06-12-2013 | |||
L8106_22089 homologs family | FisPCC73103_2341 | Fischerella muscicola | PCC73103 (SAG 1427-1) | PC+PEC | 297 | 06-12-2013 | |||
L8106_22089 homologs family | Scytonema_PCC7110_joined_4761 | Scytonema hofmanni | PCC7110 | PC+PEC | 389 | 06-12-2013 | |||
L8106_22089 homologs family | Osc10802DRAFT_2033 | Oscillatoria sp. | PCC10802 | PC+PEI | 376 | 06-12-2013 | |||
L8106_22089 homologs family | PCC9339DRAFT_04646 | Fischerella sp. | PCC9339 | PC+PEC | 335 | 06-12-2013 | |||
L8106_22089 homologs family | Ana7108_3306 | Anabaena sp. | PCC7108 | PC+PEC | 388 | 06-12-2013 | |||
L8106_22089 homologs family | Chloroglopsis_PCC9212_joined_1928 | Chlorogloeopsis sp. | PCC9212 | PC+PEC | 381 | 06-12-2013 | |||
L8106_22089 homologs family | UYC_02940 | Chlorogloeopsis fritschii | PCC6912 | PC+PEC | 381 | 06-12-2013 | |||
L8106_22089 homologs family | FisPCC7414_5280 | Fischerella muscicola | PCC7414 | PC+PEC | 334 | 06-12-2013 | |||
L8106_22089 homologs family | Fischerella_sp._PCC7521_2408 | Fischerella thermalis | PCC7521 | PC+PEC | 281 | 06-12-2013 | |||
MC7420_3535 homologs family | MC7420_3535 | ZP_05029509.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 1322 | 12-05-2011 | ||
MC7420_3535 homologs family | IPF_2632 | CAO90937.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | 1500 | 12-05-2011 | |
MC7420_3535 homologs family | Tery_1841 | YP_721570.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 1343 | 12-05-2011 | ||
MC7420_3535 homologs family | LYNGBM3L_29440 | ZP_08428664.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1405 | 12-05-2011 | |
MC7420_3535 homologs family | alr1903 | NP_485943.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 1547 | 12-05-2011 | ||
MC7420_3535 homologs family | N9414_03573 | ZP_01630825.1 | Nodularia spumigena | CCY9414 | PC | 1 | 1285 | 12-05-2011 | |
MC7420_3535 homologs family | ZP_08491193.1 | ZP_08491193.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 1179 | 12-05-2011 | |
MC7420_3535 homologs family | Cyan7822_4279 | YP_003889472.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 1244 | 12-05-2011 | |
MC7420_3535 homologs family | MAE_07890 | YP_001655803.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | 890 | 12-06-2011 | |
MC7420_3535 homologs family | LYNGBM3L_30460 | ZP_08428879.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1365 | 12-06-2011 | |
MC7420_3535 homologs family | MC7420_6333 | ZP_05026152.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 1184 | 12-06-2011 | ||
MC7420_3535 homologs family | PCC7424_1133 | YP_002376452.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 951 | 12-06-2011 | |
MC7420_3535 homologs family | OSCI_180019 | ZP_07108594.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 1008 | 12-06-2011 | |
MC7420_3535 homologs family | Ava_3508 | YP_324010.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | 1148 | 12-06-2011 | ||
MC7420_3535 homologs family | MC7420_6677 | ZP_05028167.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 1432 | 12-06-2011 | ||
MC7420_3535 homologs family | MC7420_6046 | ZP_05027237.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 1260 | 12-06-2011 | ||
MC7420_3535 homologs family | all3465 | NP_487505.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 1119 | 12-06-2011 | ||
MC7420_3535 homologs family | NIES39_J02930 | BAI91340.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 1219 | 01-10-2012 | |
MC7420_3535 homologs family | Tery_0826 | YP_720713.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 1328 | 12-06-2011 | ||
MC7420_3535 homologs family | MC7420_4498 | ZP_05028866.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 923 | 12-06-2011 | ||
MC7420_3535 homologs family | LYNGBM3L_55810 | ZP_08427827.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1106 | 12-06-2011 | |
MC7420_3535 homologs family | LYNGBM3L_00970 | ZP_08427981.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1139 | 12-06-2011 | |
MC7420_3535 homologs family | LYNGBM3L_75690 | ZP_08427936.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1108 | 12-06-2011 | |
MC7420_3535 homologs family | N9414_06844 | ZP_01628936.1 | Nodularia spumigena | CCY9414 | PC | 1 | 936 | 12-06-2011 | |
MC7420_3535 homologs family | MicvaDRAFT_0024 | ZP_08495704.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 981 | 12-06-2011 | |
MC7420_3535 homologs family | all3892 | NP_487932.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 874 | 12-06-2011 | ||
MC7420_3535 homologs family | AmaxDRAFT_1081 | ZP_03272263.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 1093 | 12-06-2011 | |
MC7420_3535 homologs family | NIES39_K01090 | BAI91758.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 892 | 12-06-2011 | |
MC7420_3535 homologs family | OSCI_440025 | ZP_07108865.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 992 | 12-07-2011 | |
MC7420_3535 homologs family | alr2986 | NP_487026.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 885 | 12-07-2011 | ||
MC7420_3535 homologs family | IPF_2635 | CAO90934.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | Much shorter than other MC7420_3535 homologs | 263 | 12-07-2011 |
MC7420_3535 homologs family | L8106_24365 | ZP_01619849.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 1044 | 12-07-2011 | |
MC7420_3535 homologs family | PCC7424_1763 | YP_002377065.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 1475 | 12-07-2011 | |
MC7420_3535 homologs family | MC7420_2915 | ZP_05024179.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 1355 | 12-07-2011 | ||
MC7420_3535 homologs family | LYNGBM3L_40770 | ZP_08429450.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 1273 | 12-07-2011 | |
MC7420_3535 homologs family | AmaxDRAFT_0188 | ZP_03271372.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 786 | 12-07-2011 | |
MC7420_3535 homologs family | PCC8801_0753 | YP_002370992.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 838 | 12-07-2011 | |
MC7420_4701 homologs family | MC7420_4701 | ZP_05025511.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 455 | 11-30-2011 | ||
MC7420_4701 homologs family | Cyan7822_1857 | YP_003887117.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 457 | 11-30-2011 | |
MC7420_4701 homologs family | MicvaDRAFT_1724 | ZP_08491624.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | Sequence shortened at N-term (104 aa removed: MNSAATLIQQLPELSDAQFHQKYLKQKQGMRTLATILPQVEQQSLALRAVKLALKVNLKLGSKLAGTVKPEFQIATIKLIEKIPTSPLLKIQLLALTSSDMAIP) | 534 | 09-11-2012 |
MC7420_4701 homologs family | MC7420_1061 | ZP_05028540.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | This sequence has a much shorter N-term than others. But not a frameshift. | 173 | 09-11-2012 | |
MC7420_4701 homologs family | Osc7112_2212 | YP_007115088.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 638 | 04-24-2013 | |
MC7420_4701 homologs family | Osc10802DRAFT_3523 | Oscillatoria sp. | PCC10802 | PC+PEI | 550 | 06-12-2013 | |||
CotB family | S7335_4506 | ZP_05038065.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | 220 | 09-26-2011 | |
CotB family | CwatDRAFT_1185 | ZP_00517831.1 | Crocosphaera watsonii | WH8501 | PC+PEI | 218 | 09-26-2011 | ||
CotB family | PCC7424_5727 | YP_002381022.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 218 | 09-26-2011 | |
CotB family | PCC7424_1391 | YP_002376703.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 219 | 09-26-2011 | |
CotB family | Cyan7425_3035 | YP_002483730.1 | Cyanothece sp. | PCC7425 | PC | 1 | 222 | 09-26-2011 | |
CotB family | Cyan7822_0127 | YP_003885453.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 219 | 09-26-2011 | |
CotB family | Cyan7822_4037 | YP_003889237.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 220 | 09-26-2011 | |
CotB family | gi|33090216|gb|AAP93903.1| | AAP93903.1 | Fremyella diplosiphon (Tolypothrix sp. / Calothrix sp.) | Fd33 (UTEX481/PCC7601) | PC+PEI | CA3 | 219 | 09-26-2011 | |
CotB family | gvip178 | NP_924203.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | 217 | 11-24-2011 | |
CotB family | GL6909_0631 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 219 | 08-30-2011 | ||
CotB family | Npun_R0734 | YP_001864429.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 220 | 09-26-2011 | |
CotB family | Tery_2382 | YP_722075.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | N-term shortened (15 aa removed: MLVYVKKGKQNSQII) | 219 | 09-26-2011 | |
CotB family | LYNGBM3L_16600 | ZP_08428239.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 218 | 10-28-2011 | |
CotB family | MicvaDRAFT_0237 | ZP_08495395.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 218 | 10-28-2011 | |
CotB family | GL6909_3542 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 218 | 11-24-2011 | ||
CotB family | CWATWH0003_4320 | EHJ10938.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 218 | 02-22-2012 | ||
CotB family | Ple7327_3416 | YP_007082181.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 218 | 04-24-2013 | ||
CotB family | Mic7113_4739 | YP_007123818.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 227 | 04-24-2013 | |
CotB family | Xen7305DRAFT_00028590 | ZP_21055352.1 | Xenococcus sp. | PCC7305 | PC+PEI | 218 | 04-24-2013 | ||
CotB family | Osc7112_1071 | YP_007114038.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 218 | 04-24-2013 | |
CotB family | Osc7112_1024 | YP_007113998.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 218 | 04-24-2013 | |
CotB family | Sta7437_3034 | YP_007133518.1 | Stanieria cyanosphaera | PCC7437 | PC+PEI | 218 | 04-29-2013 | ||
CotB family | Cal6303_3397 | YP_007138304.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 219 | 04-29-2013 | |
CotB family | Osc10802DRAFT_2573 | Oscillatoria sp. | PCC10802 | PC+PEI | 218 | 06-12-2013 | |||
CotB homologs 1 family | sync_0128 | YP_729365.1 | Synechococcus sp. | CC9311 | PC+PEI+PEII | 3dA/CA4-A | 208 | 09-26-2011 | |
CotB homologs 1 family | Syncc9605_0122 | YP_380453.1 | Synechococcus sp. | CC9605 | PC+PEI+PEII | 3c | 204 | 09-26-2011 | |
CotB homologs 1 family | SH8109_0378 | ZP_05790768.1 | Synechococcus sp. | WH8109 | PC+PEI+PEII | 3bB | 204 | 09-26-2011 | |
CotB homologs 1 family | SYNW0139 | NP_896234.1 | Synechococcus sp. | WH8102 | PC+PEI+PEII | 3c | 205 | 09-26-2011 | |
CotB homologs 1 family | Syncc9902_0166 | YP_376184.1 | Synechococcus sp. | CC9902 | PC+PEI+PEII | 3dA/CA4-A | 203 | 09-26-2011 | |
CotB homologs 1 family | BL107_05959 | ZP_01468938.1 | Synechococcus sp. | BL107 | PC+PEI+PEII | 3dA/CA4-A | 203 | 09-26-2011 | |
CotB homologs 1 family | SynWH7803_0189 | YP_001223912.1 | Synechococcus sp. | WH7803 | PC+PEI+PEII | 3a | 208 | 09-26-2011 | |
CotB homologs 1 family | WH7805_08566 | ZP_01123713.1 | Synechococcus sp. | WH7805 | PC+PEI | 2 | 208 | 09-26-2011 | |
CotB homologs 1 family | RS9917_05100 | ZP_01079060.1 | Synechococcus sp. | RS9917 | PC | 1 | 211 | 09-26-2011 | |
CotB homologs 1 family | RS9916_38227 | ZP_01471676.1 | Synechococcus sp. | RS9916 | PC+PEI+PEII | 3dA/CA4-A | 207 | 09-26-2011 | |
CotB homologs 1 family | WH5701_01640 | ZP_01084821.1 | Synechococcus sp. | WH5701 | PC | 1 | 210 | 09-26-2011 | |
CotB homologs 1 family | SynRCC307_0128 | YP_001226384.1 | Synechococcus sp. | RCC307 | PC+PEI+PEII | 3eA | 177 | 12-05-2011 | |
CotB homologs 1 family | SCB01_010100014119 | ZP_07974801.1 | Synechococcus sp. | CB0101 | PC | 1 | 196 | 11-04-2011 | |
CotB homologs 1 family | SCB02_010100002826 | ZP_07969839.1 | Synechococcus sp. | CB0205 | PC+PEI | 2 | 193 | 05-24-2012 | |
CotB homologs 1 family | CPCC7001_2625 | ZP_05046435.1 | Cyanobium sp. | PCC7001 | PC | 1 | 215 | 09-26-2011 | |
CotB homologs 1 family | Syn8016DRAFT_1730 | ZP_08956385.1 | Synechococcus sp. | WH8016 | PC+PEI+PEII | 3aA | 208 | 11-04-2011 | |
CotB homologs 1 family | Cyan7425_3615 | YP_002484296.1 | Cyanothece sp. | PCC7425 | PC | 1 | 221 | 09-26-2011 | |
CotB homologs 1 family | Synpcc7942_2325 | YP_401342.1 | Synechococcus elongatus | PCC7942 | PC | 1 | N-term shortened (30 aa removed : MASAIAKLSAAPASVTPCGSVKDERLSCAS) | 225 | 08-28-2012 |
CotB homologs 1 family | syc1777_d | YP_172487.1 | Synechococcus elongatus | PCC6301 (ATCC 27144) | PC | 1 | 225 | 09-26-2011 | |
CotB homologs 1 family | Cyagr_2203 | YP_007046657.1 | Cyanobium gracile | PCC6307 | PC | 199 | 04-29-2013 | ||
CotB homologs 2 family | SYNPCC7002_A1440 | YP_001734687.1 | Synechococcus sp. | PCC7002 | PC | 1 | 222 | 09-26-2011 | |
CotB homologs 2 family | slr1687 | NP_441698.1 | Synechocystis sp. | PCC6803 (ATCC27184) | PC | 1 | 223 | 09-26-2011 | |
CotB homologs 2 family | alr0616 | NP_484660.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | 226 | 09-26-2011 | ||
CotB homologs 2 family | Ava_4548 | YP_325041.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | 226 | 09-27-2011 | ||
CotB homologs 2 family | AmaxDRAFT_5534 | ZP_03276708.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | 6 aa missing on N-term (start scaffold) | 217 | 09-26-2011 |
CotB homologs 2 family | cce_3774 | YP_001805188.1 | Cyanothece sp. | ATCC51142 | PC | 1 | 223 | 09-26-2011 | |
CotB homologs 2 family | PCC7424_0572 | YP_002375902.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | 223 | 09-26-2011 | |
CotB homologs 2 family | PCC8801_1381 | YP_002371597.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | 220 | 09-26-2011 | |
CotB homologs 2 family | Cyan8802_1415 | YP_003137167.1 | Cyanothece sp. | PCC8802 | PC | 1 | 220 | 09-26-2011 | |
CotB homologs 2 family | FJSC11DRAFT_1072 | ZP_08984866.1 | Fischerella sp. (Mastigocladus laminosus) | JSC-11 | PC+PEC | 226 | 11-04-2011 | ||
CotB homologs 2 family | gvip128 | NP_923927.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | 233 | 11-24-2011 | |
CotB homologs 2 family | gvip219 | NP_924521.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | 234 | 11-24-2011 | |
CotB homologs 2 family | L8106_28841 | ZP_01621447.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 226 | 09-26-2011 | |
CotB homologs 2 family | MC7420_7088 | ZP_05023236.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | 226 | 09-26-2011 | ||
CotB homologs 2 family | MAE_56800 | YP_001660694.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | 222 | 09-26-2011 | |
CotB homologs 2 family | N9414_02366 | ZP_01632466.1 | Nodularia spumigena | CCY9414 | PC | 1 | 226 | 09-26-2011 | |
CotB homologs 2 family | Npun_R1155 | YP_001864824.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | 226 | 09-26-2011 | |
CotB homologs 2 family | CYB_1190 | YP_477428.1 | Synechococcus sp. | JA-2-3B'a(2-13) | PC | 1 | 244 | 09-26-2011 | |
CotB homologs 2 family | CYA_0047 | YP_473542.1 | Synechococcus sp. | JA-3-3Ab | PC | 1 | 240 | 09-13-2012 | |
CotB homologs 2 family | tll0835 | NP_681625.1 | Thermosynechococcus elongatus | BP-1 | PC | 1 | 230 | 09-26-2011 | |
CotB homologs 2 family | Tery_4762 | YP_724189.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | 223 | 09-26-2011 | ||
CotB homologs 2 family | AM1_0043 | YP_001514445.1 | Acaryochloris marina | MBIC11017 (AM1) | PC | 1 | 221 | 09-26-2011 | |
CotB homologs 2 family | OSCI_2700008 | ZP_07110882.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 225 | 10-19-2011 | |
CotB homologs 2 family | CRD_00077 | ZP_06303582.1 | Raphidiopsis brookii | D9 | PC | 1 | 232 | 10-28-2011 | |
CotB homologs 2 family | CRC_02169 | ZP_06308244.1 | Cylindrospermopsis raciborskii | CS-505 | PC | 1 | 223 | 10-28-2011 | |
CotB homologs 2 family | OSCI_2700008 | ZP_07110882.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 225 | 10-28-2011 | |
CotB homologs 2 family | LYNGBM3L_17970 | ZP_08426427.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 223 | 10-28-2011 | |
CotB homologs 2 family | MicvaDRAFT_3625 | ZP_08493520.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 224 | 10-28-2011 | |
CotB homologs 2 family | NIES39_J05080 | BAI91554.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 224 | 10-28-2011 | |
CotB homologs 2 family | IPF_3444 | CAO90548.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | 222 | 10-28-2011 | |
CotB homologs 2 family | Cyan7822_1692 | YP_003886956.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | 223 | 11-24-2011 | |
CotB homologs 2 family | CwatDRAFT_4214 | ZP_00515817.1 | Crocosphaera watsonii | WH8501 | PC+PEI | 223 | 11-24-2011 | ||
CotB homologs 2 family | S7335_3847 | ZP_05037409.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | 227 | 11-24-2011 | |
CotB homologs 2 family | Cyan7425_1323 | YP_002482061.1 | Cyanothece sp. | PCC7425 | PC | 1 | 212 | 11-24-2011 | |
CotB homologs 2 family | syc2370_d | YP_173080.1 | Synechococcus elongatus | PCC6301 (ATCC 27144) | PC | 1 | 234 | 11-24-2011 | |
CotB homologs 2 family | Synpcc7942_1721 | YP_400738.1 | Synechococcus elongatus | PCC7942 | PC | 1 | 234 | 11-24-2011 | |
CotB homologs 2 family | GL6909_0310 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | 221 | 11-24-2011 | ||
CotB homologs 2 family | CMS328C | Cyanidioschyzon merolae | 10D | PC | 1 | on contig c19f0009, found by tblastn | 332 | 02-21-2012 | |
CotB homologs 2 family | CMM226C | Cyanidioschyzon merolae | 10D | PC | 1 | on contig c13f0002, found by tblastn | 420 | 02-21-2012 | |
CotB homologs 2 family | Cy51472DRAFT_2076 | ZP_08973280.1 | Cyanothece sp. | ATCC51472 | PC | 1 | 223 | 01-10-2012 | |
CotB homologs 2 family | AplaP_010100006817 | ZP_06381377.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | Incomplete - lacks C-term (end of contig) | 154 | 09-13-2012 |
CotB homologs 2 family | ACCM5_010100026572 | ZP_09250884.1 | Acaryochloris sp. | CCMEE5410 | APC only | 221 | 01-24-2012 | ||
CotB homologs 2 family | CWATWH0003_2253 | EHJ13064.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 213 | 02-22-2012 | ||
CotB homologs 2 family | MICAI_560046 | ZP_10229858.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 222 | 08-22-2012 | |
CotB homologs 2 family | MICAG_930009 | CCI29658.1 | Microcystis aeruginosa | PCC9808 | PC | 1 | 222 | 08-22-2012 | |
CotB homologs 2 family | MICAB_5520009 | CCH98899.1 | Microcystis aeruginosa | PCC9717 | PC | 1 | 222 | 08-23-2012 | |
CotB homologs 2 family | MICAK_3340002 | CCI37520.1 | Microcystis aeruginosa | PCC9701 | PC | 1 | 222 | 08-23-2012 | |
CotB homologs 2 family | MICAC_1120010 | CCI00724.1 | Microcystis aeruginosa | PCC9443 | PC | 1 | 222 | 08-23-2012 | |
CotB homologs 2 family | MICCA_1100006 | ZP_18815796.1 | Microcystis aeruginosa | PCC9432 | PC | 1 | 222 | 04-22-2013 | |
CotB homologs 2 family | MICAD_2540004 | CCI07477.1 | Microcystis aeruginosa | PCC7941 | PC | 1 | 222 | 08-23-2012 | |
CotB homologs 2 family | Anacy_0108 | YP_007154627.1 | Anabaena cylindrica | PCC7122 | PC+PEC | 226 | 04-24-2013 | ||
CotB homologs 2 family | Osc7112_1203 | YP_007114165.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 224 | 04-24-2013 | |
CotB homologs 2 family | Syn7509DRAFT_00016380 | ZP_21042037.1 | Synechocystis sp. | PCC7509 | PC | 286 | 04-24-2013 | ||
CotB homologs 2 family | Chro_1677 | YP_007091065.1 | Chroococcidiopsis thermalis | PCC7203 | PC+PEC | 222 | 04-24-2013 | ||
CotB homologs 2 family | GLO73106DRAFT_00011310 | ZP_21051666.1 | Gloeocapsa sp. | PCC73106 | PC+PEI | 218 | 04-24-2013 | ||
CotB homologs 2 family | Cylst_0831 | YP_007145837.1 | Cylindrospermum stagnale | PCC7417 | PC+PEC | 224 | 04-24-2013 | ||
CotB homologs 2 family | Glo7428_4423 | YP_007130026.1 | Gloeocapsa sp. | PCC7428 | PC | 224 | 04-24-2013 | ||
CotB homologs 2 family | Cyast_2481 | YP_007166073.1 | Cyanobacterium stanieri | PCC7202 | PC | 223 | 04-24-2013 | ||
CotB homologs 2 family | Riv7116_2427 | YP_007055489.1 | Rivularia sp. | PCC7116 | PC+PEC | 227 | 04-24-2013 | ||
CotB homologs 2 family | Ple7327_2704 | YP_007081541.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 226 | 04-24-2013 | ||
CotB homologs 2 family | Nos7524_3942 | YP_007077312.1 | Nostoc sp. | PCC7524 | PC+PEC | 226 | 04-24-2013 | ||
CotB homologs 2 family | Mic7113_0797 | YP_007120111.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 223 | 04-24-2013 | |
CotB homologs 2 family | ZP_20932003 | ZP_20932003.1 | Microcystis aeruginosa | TAIHU98 | PC | 1 | 222 | 04-24-2013 | |
CotB homologs 2 family | ZP_18907631 | ZP_18907631.1 | Leptolyngbya sp. | PCC7375 | PC+PEI | 2 | 228 | 04-24-2013 | |
CotB homologs 2 family | Lepto7376_3616 | YP_007072630.1 | Leptolyngbya sp. | PCC7376 | PC+PEI | 223 | 04-24-2013 | ||
CotB homologs 2 family | Xen7305DRAFT_00015010 | ZP_21056717.1 | Xenococcus sp. | PCC7305 | PC+PEI | 224 | 04-24-2013 | ||
CotB homologs 2 family | Pse7367_3483 | YP_007104147.1 | Pseudanabaena sp. | PCC7367 | PC+PEI | 223 | 04-24-2013 | ||
CotB homologs 2 family | Nos7107_3742 | YP_007051453.1 | Nostoc sp. | PCC7107 | PC+PEC | 226 | 04-29-2013 | ||
CotB homologs 2 family | Cri9333_3249 | YP_007143591.1 | Crinalium epipsammum | PCC9333 | PC | 224 | 04-29-2013 | ||
CotB homologs 2 family | Cal7507_3606 | YP_007066832.1 | Calothrix sp. | PCC7507 | PC+PEC | 228 | 04-29-2013 | ||
CotB homologs 2 family | Sta7437_1180 | YP_007131717.1 | Stanieria cyanosphaera | PCC7437 | PC+PEI | 220 | 04-29-2013 | ||
CotB homologs 2 family | Cal6303_1973 | YP_007136978.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 226 | 04-29-2013 | |
CotB homologs 2 family | Cyan10605_2501 | YP_007162626.1 | Cyanobacterium aponimum | PCC10605 | 222 | 04-29-2013 | |||
CotB homologs 2 family | Syn6312_1448 | YP_007061159.1 | Synechococcus sp. | PCC6312 | PC | 234 | 04-29-2013 | ||
CotB homologs 2 family | GEI7407_1098 | YP_007108647.1 | Geitlerinema sp. | PCC7407 | PC | 226 | 04-29-2013 | ||
CotB homologs 2 family | Cha6605_3987 | YP_007098476.1 | Chamaesiphon minutus | PCC6605 | PC+PEI | 229 | 04-29-2013 | ||
CotB homologs 2 family | Oscil6304_5510 | YP_007088914.1 | Oscillatoria acuminata | PCC6304 (SAG 1449-3) | PC | 225 | 04-29-2013 | ||
CotB homologs 2 family | Lep6406DRAFT_00051850 | ZP_21043592.1 | Leptolyngbya sp. | PCC6406 | PC+PEC | 223 | 04-29-2013 | ||
CotB homologs 2 family | Pse7429DRAFT_2304 | ZP_21066416.1 | Pseudanabaena sp. (biceps) | PCC7429 | PC | 226 | 04-29-2013 | ||
CotB homologs 2 family | Syn7502_02529 | YP_007106636.1 | Synechococcus sp. | PCC7502 | PC | 229 | 04-29-2013 | ||
CotB homologs 2 family | LepboDRAFT_3278 | Leptolyngbya boryana | PCC6306 | PC | 234 | 06-11-2013 | |||
CotB homologs 2 family | Fis9431DRAFT_3726 | Fischerella sp. | PCC9431 | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | FIS9605DRAFT_06980 | Fischerella sp. | PCC9605 | PC+PEC | 224 | 06-12-2013 | |||
CotB homologs 2 family | FisPCC73103_3407 | Fischerella muscicola | PCC73103 (SAG 1427-1) | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | Scytonema_PCC7110_joined_11888 | Scytonema hofmanni | PCC7110 | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | Osc10802DRAFT_5467 | Oscillatoria sp. | PCC10802 | PC+PEI | 224 | 06-12-2013 | |||
CotB homologs 2 family | PCC9339DRAFT_01728 | Fischerella sp. | PCC9339 | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | Ana7108_2981 | Anabaena sp. | PCC7108 | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | Chloroglopsis_PCC9212_joined_7597 | Chlorogloeopsis sp. | PCC9212 | PC+PEC | 238 | 06-12-2013 | |||
CotB homologs 2 family | UYC_05285 | Chlorogloeopsis fritschii | PCC6912 | PC+PEC | 238 | 06-12-2013 | |||
CotB homologs 2 family | FisPCC7414_4392 | Fischerella muscicola | PCC7414 | PC+PEC | 226 | 06-12-2013 | |||
CotB homologs 2 family | Fischerella_sp._PCC7521_3617 | Fischerella thermalis | PCC7521 | PC+PEC | 226 | 06-12-2013 | |||
NblB family | L8106_00260 | ZP_01624763.1 | Lyngbya aestuarii | CCY9616 (PCC8106/CCY8106) | PC | 1 | 223 | 09-26-2011 | |
NblB family | S7335_5595 | ZP_05039147.1 | Synechococcus sp. | PCC7335 | PC+PEI | CA3 | Blastp | 223 | 09-26-2011 |
NblB family | SYNPCC7002_A0348 | YP_001733614.1 | Synechococcus sp. | PCC7002 | PC | 1 | Blastp | 218 | 09-26-2011 |
NblB family | sll1663 | NP_440142.1 | Synechocystis sp. | PCC6803 (ATCC27184) | PC | 1 | Blastp | 220 | 09-26-2011 |
NblB family | alr3814 | NP_487854.1 | Anabaena (Nostoc) sp. | PCC7120 | PC+PEC | Blastp | 220 | 09-26-2011 | |
NblB family | Ava_1888 | YP_322405.1 | Anabaena variabilis | ATCC29413 (PCC7937) | PC+PEC | Blastp | 220 | 09-27-2011 | |
NblB family | Aazo_0577 | YP_003720196.1 | Anabaena (Nostoc) azollae | 0708 | PC+PEC | Blastp | 218 | 09-26-2011 | |
NblB family | AmaxDRAFT_4484 | ZP_03275659.1 | Arthrospira (Spirulina) maxima | CS-328 | PC | 1 | Blastp | 220 | 09-26-2011 |
NblB family | CwatDRAFT_3505 | ZP_00516591.1 | Crocosphaera watsonii | WH8501 | PC+PEI | Blastp | 219 | 09-26-2011 | |
NblB family | cce_3386 | YP_001804800.1 | Cyanothece sp. | ATCC51142 | PC | 1 | N-term shortened (15 aa removed: MRWFLVNILIYPFII) | 219 | 09-13-2012 |
NblB family | PCC7424_2563 | YP_002377847.1 | Cyanothece sp. | PCC7424 | PC+PEI | 2 | Blastp | 220 | 09-26-2011 |
NblB family | Cyan7425_1432 | YP_002482166.1 | Cyanothece sp. | PCC7425 | PC | 1 | Blastp | 220 | 09-26-2011 |
NblB family | PCC8801_0932 | YP_002371165.1 | Cyanothece sp. | PCC8801 | PC+PEI | 2 | Blastp | 220 | 09-26-2011 |
NblB family | Cyan8802_0959 | YP_003136728.1 | Cyanothece sp. | PCC8802 | PC | 1 | Blastp | 220 | 09-26-2011 |
NblB family | CY0110_12007 | ZP_01731445.1 | Cyanothece sp. | CCY0110 | PC | 1 | Blastp | 219 | 09-26-2011 |
NblB family | Cyan7822_3518 | YP_003888735.1 | Cyanothece sp. | PCC7822 | PC+PEI | 2 | Blastp | 220 | 09-26-2011 |
NblB family | gvip306 | NP_925180.1 | Gloeobacter violaceus | PCC7421 | PC+PEI | 2 | Blastp | 215 | 11-24-2011 |
NblB family | MC7420_7663 | ZP_05023685.1 | Microcoleus chthonoplastes | PCC7420 | PC+PEC | N-term shortened (11 aa removed: MSDYLLLNTLQ) | 218 | 09-13-2012 | |
NblB family | MAE_14280 | YP_001656442.1 | Microcystis aeruginosa | NIES-843 | PC | 1 | Blastp | 221 | 09-26-2011 |
NblB family | N9414_09806 | ZP_01630150.1 | Nodularia spumigena | CCY9414 | PC | 1 | Blastp | 220 | 09-26-2011 |
NblB family | Npun_R5793 | YP_001869034.1 | Nostoc punctiforme | ATCC29133 (PCC73102) | PC+PEI | 2 | Blastp | 221 | 09-26-2011 |
NblB family | Synpcc7942_1823 | YP_400840.1 | Synechococcus elongatus | PCC7942 | PC | 1 | 219 | 08-28-2012 | |
NblB family | syc2271_d | YP_172981.1 | Synechococcus elongatus | PCC6301 (ATCC 27144) | PC | 1 | Blastp | 221 | 09-26-2011 |
NblB family | CYB_0185 | YP_476448.1 | Synechococcus sp. | JA-2-3B'a(2-13) | PC | 1 | Blastp | 227 | 09-26-2011 |
NblB family | CYA_2789 | YP_476154.1 | Synechococcus sp. | JA-3-3Ab | PC | 1 | Blastp | 226 | 09-26-2011 |
NblB family | tlr0766 | NP_681555.1 | Thermosynechococcus elongatus | BP-1 | PC | 1 | Blastp | 226 | 09-26-2011 |
NblB family | Tery_2239 | YP_721941.1 | Trichodesmium erythraeum | IMS101 | PC+PEI | Blastp | 220 | 09-26-2011 | |
NblB family | CRD_02854 | ZP_06306309.1 | Raphidiopsis brookii | D9 | PC | 1 | 226 | 10-28-2011 | |
NblB family | CRC_01060 | ZP_06307576.1 | Cylindrospermopsis raciborskii | CS-505 | PC | 1 | 226 | 10-28-2011 | |
NblB family | OSCI_3860033 | ZP_07113489.1 | Oscillatoria sp. | PCC6506 (PCC9029/ATCC29081 /UTEX 1547) | PC | 1 | 220 | 10-28-2011 | |
NblB family | LYNGBM3L_66920 | ZP_08431562.1 | Lyngbya majuscula | 3L | PC+PEI | 2 | 220 | 10-28-2011 | |
NblB family | MicvaDRAFT_5366 | ZP_08492865.1 | Microcoleus vaginatus | FGP-2 | PC | 1 | 224 | 10-28-2011 | |
NblB family | NIES39_D03910 | BAI89809.1 | Arthrospira (Spirulina) platensis | NIES-39 | PC | 1 | 220 | 10-28-2011 | |
NblB family | IPF_2775 | CAO89282.1 | Microcystis aeruginosa | PCC7806 | PC | 1 | 221 | 10-28-2011 | |
NblB family | FJSC11DRAFT_0382 | ZP_08984176.1 | Fischerella sp. (Mastigocladus laminosus) | JSC-11 | PC+PEC | 221 | 11-24-2011 | ||
NblB family | GL6909_3251 | Gloeothece sp. | PCC6909/1 | PC+PEI | 2 | Truncated because the original orf was fused with another | 220 | 11-30-2011 | |
NblB family | Cy51472DRAFT_2453 | ZP_08973657.1 | Cyanothece sp. | ATCC51472 | PC | 1 | 219 | 01-10-2012 | |
NblB family | AplaP_010100017289 | ZP_06383430.1 | Arthrospira (Spirulina) platensis | Paraca | PC | 1 | N-term shortened (18 aa removed: MRVAPDLNRQQLLNCLTK) | 220 | 09-13-2012 |
NblB family | CWATWH0003_3083 | EHJ12197.1 | Crocosphaera watsonii | WH0003 | PC+PEI | 219 | 02-22-2012 | ||
NblB family | MICAI_3110003 | ZP_10229074.1 | Microcystis sp. | T1-4 | PC+PEI | 2 | 221 | 08-22-2012 | |
NblB family | MICAG_200023 | CCI23270.1 | Microcystis aeruginosa | PCC9808 | PC | 1 | 221 | 08-22-2012 | |
NblB family | MICAB_4960020 | CCH98552.1 | Microcystis aeruginosa | PCC9717 | PC | 1 | 221 | 08-23-2012 | |
NblB family | MICAK_580022 | CCI38703.1 | Microcystis aeruginosa | PCC9701 | PC | 1 | 221 | 08-23-2012 | |
NblB family | MICAC_3690016 | CCI02719.1 | Microcystis aeruginosa | PCC9443 | PC | 1 | 221 | 08-23-2012 | |
NblB family | MICAD_2940015 | CCI08016.1 | Microcystis aeruginosa | PCC7941 | PC | 1 | 221 | 08-23-2012 | |
NblB family | Cylst_5091 | YP_007149816.1 | Cylindrospermum stagnale | PCC7417 | PC+PEC | 220 | 04-24-2013 | ||
NblB family | Anacy_2696 | YP_007157043.1 | Anabaena cylindrica | PCC7122 | PC+PEC | 220 | 04-24-2013 | ||
NblB family | Nos7524_4874 | YP_007078199.1 | Nostoc sp. | PCC7524 | PC+PEC | 220 | 04-24-2013 | ||
NblB family | Mic7113_4080 | YP_007123190.1 | Microcoleus sp. | PCC7113 | PC+PEI | 2 | 218 | 04-24-2013 | |
NblB family | Osc7112_0710 | YP_007113716.1 | Oscillatoria nigro-viridis | PCC7112 | PC+PEI | 2 | 224 | 04-24-2013 | |
NblB family | ZP_20934124 | ZP_20934124.1 | Microcystis aeruginosa | TAIHU98 | PC | 1 | 221 | 04-24-2013 | |
NblB family | Syn7509DRAFT_00041170 | ZP_21039471.1 | Synechocystis sp. | PCC7509 | PC | 220 | 04-24-2013 | ||
NblB family | Ple7327_1847 | YP_007080751.1 | Pleurocapsa sp. | PCC7327 | PC+PEI | 219 | 04-24-2013 | ||
NblB family | Lepto7376_0558 | YP_007069818.1 | Leptolyngbya sp. | PCC7376 | PC+PEI | 218 | 04-24-2013 | ||
NblB family | Xen7305DRAFT_00012810 | ZP_21056844.1 | Xenococcus sp. | PCC7305 | PC+PEI | 219 | 04-24-2013 | ||
NblB family | Glo7428_4688 | YP_007130281.1 | Gloeocapsa sp. | PCC7428 | PC | 223 | 04-24-2013 | ||
NblB family | Chro_0989 | YP_007090391.1 | Chroococcidiopsis thermalis | PCC7203 | PC+PEC | 219 | 04-24-2013 | ||
NblB family | Riv7116_0216 | YP_007053370.1 | Rivularia sp. | PCC7116 | PC+PEC | 218 | 04-24-2013 | ||
NblB family | GLO73106DRAFT_00006030 | ZP_21052179.1 | Gloeocapsa sp. | PCC73106 | PC+PEI | 218 | 04-24-2013 | ||
NblB family | PCC7418_1214 | YP_007167630.1 | Halothece sp. | PCC7418 | PC | 224 | 04-24-2013 | ||
NblB family | ZP_18908692 | ZP_18908692.1 | Leptolyngbya sp. | PCC7375 | PC+PEI | 2 | 223 | 04-24-2013 | |
NblB family | Cyast_1913 | YP_007165517.1 | Cyanobacterium stanieri | PCC7202 | PC | 221 | 04-24-2013 | ||
NblB family | Dacsa_1202 | YP_007171258.1 | Dactylococcopsis salina | PCC8305 | 224 | 04-24-2013 | |||
NblB family | Cal7507_1540 | YP_007064834.1 | Calothrix sp. | PCC7507 | PC+PEC | 220 | 04-29-2013 | ||
NblB family | Sta7437_3389 | YP_007133861.1 | Stanieria cyanosphaera | PCC7437 | PC+PEI | 220 | 04-29-2013 | ||
NblB family | MICCA_930006 | ZP_18815469.1 | Microcystis aeruginosa | PCC9432 | PC | 1 | 221 | 04-29-2013 | |
NblB family | Nos7107_4026 | YP_007051729.1 | Nostoc sp. | PCC7107 | PC+PEC | 221 | 04-29-2013 | ||
NblB family | Cri9333_0875 | YP_007141302.1 | Crinalium epipsammum | PCC9333 | PC | 221 | 04-29-2013 | ||
NblB family | Cal6303_0988 | YP_007136025.1 | Calothrix sp. | PCC6303 | PC+PEI | 2 | 218 | 04-29-2013 | |
NblB family | Cyan10605_2137 | YP_007162269.1 | Cyanobacterium aponimum | PCC10605 | 219 | 04-29-2013 | |||
NblB family | Oscil6304_1780 | YP_007085378.1 | Oscillatoria acuminata | PCC6304 (SAG 1449-3) | PC | 222 | 04-29-2013 | ||
NblB family | GEI7407_0128 | YP_007107685.1 | Geitlerinema sp. | PCC7407 | PC | 220 | 04-29-2013 | ||
NblB family | Lep6406DRAFT_00023300 | ZP_21046418.1 | Leptolyngbya sp. | PCC6406 | PC+PEC | 220 | 04-29-2013 | ||
NblB family | Syn6312_0129 | YP_007059926.1 | Synechococcus sp. | PCC6312 | PC | 222 | 04-29-2013 | ||
NblB family | Cha6605_0245 | YP_007095074.1 | Chamaesiphon minutus | PCC6605 | PC+PEI | 213 | 04-29-2013 | ||
NblB family | LepboDRAFT_1028 | Leptolyngbya boryana | PCC6306 | PC | 219 | 06-11-2013 | |||
NblB family | Fis9431DRAFT_1583 | Fischerella sp. | PCC9431 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | FIS9605DRAFT_03310 | Fischerella sp. | PCC9605 | PC+PEC | 220 | 06-12-2013 | |||
NblB family | FisPCC73103_7578 | Fischerella muscicola | PCC73103 (SAG 1427-1) | PC+PEC | 221 | 06-12-2013 | |||
NblB family | Scytonema_PCC7110_joined_5306 | Scytonema hofmanni | PCC7110 | PC+PEC | 226 | 06-12-2013 | |||
NblB family | Osc10802DRAFT_5396 | Oscillatoria sp. | PCC10802 | PC+PEI | 336 | 06-12-2013 | |||
NblB family | PCC9339DRAFT_01092 | Fischerella sp. | PCC9339 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | Ana7108_1853 | Anabaena sp. | PCC7108 | PC+PEC | 218 | 06-12-2013 | |||
NblB family | Chloroglopsis_PCC9212_joined_453 | Chlorogloeopsis sp. | PCC9212 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | UYC_04806 | Chlorogloeopsis fritschii | PCC6912 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | FisPCC7414_2854 | Fischerella muscicola | PCC7414 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | Fischerella_sp._PCC7521_5286 | Fischerella thermalis | PCC7521 | PC+PEC | 221 | 06-12-2013 | |||
NblB family | Syn7502_00033 | YP_007104343.1 | Synechococcus sp. | PCC7502 | PC | 219 | 06-20-2013 | ||
NblB family | Pse7367_2182 | YP_007102874.1 | Pseudanabaena sp. | PCC7367 | PC+PEI | 241 | 06-20-2013 | ||
NblB family | Pse7429DRAFT_0756 | ZP_21065042.1 | Pseudanabaena sp. (biceps) | PCC7429 | PC | 225 | 06-20-2013 |
Model strains, Marine strains
Last update: 20 Apr 2023 10:08:13